From a9ee1a29d6f40664938bb0ab81366cc4966be70c Mon Sep 17 00:00:00 2001 From: RalfG Date: Tue, 7 Jul 2026 17:22:42 +0200 Subject: [PATCH] cleanup repo: remove old and deprecated files, including old Streamlit UI --- deeplc-todo/align.py | 845 ------ deeplc-todo/gui.py | 404 --- examples/deeplc_example.py | 78 - scripts/onnx_model.py | 31 - streamlit/.dockerignore | 5 - streamlit/.streamlit/config.toml | 19 - streamlit/Dockerfile | 7 - streamlit/README.md | 22 - streamlit/deeplc_streamlit.py | 430 --- streamlit/example_data.csv | 1367 ---------- streamlit/requirements.txt | 5 - streamlit/streamlit_utils.py | 83 - uv.lock | 4303 ++++++++++++++++++++++++++++++ 13 files changed, 4303 insertions(+), 3296 deletions(-) delete mode 100644 deeplc-todo/align.py delete mode 100644 deeplc-todo/gui.py delete mode 100644 examples/deeplc_example.py delete mode 100644 scripts/onnx_model.py delete mode 100644 streamlit/.dockerignore delete mode 100644 streamlit/.streamlit/config.toml delete mode 100644 streamlit/Dockerfile delete mode 100644 streamlit/README.md delete mode 100644 streamlit/deeplc_streamlit.py delete mode 100644 streamlit/example_data.csv delete mode 100644 streamlit/requirements.txt delete mode 100644 streamlit/streamlit_utils.py create mode 100644 uv.lock diff --git a/deeplc-todo/align.py b/deeplc-todo/align.py deleted file mode 100644 index 037e5c4..0000000 --- a/deeplc-todo/align.py +++ /dev/null @@ -1,845 +0,0 @@ -"""Align retention times across LC-MS runs from a Sage results TSV. - -This script ports the end-to-end logic from `align.ipynb` into a runnable CLI: - -* Read `results.plasma_proteomics.tsv` using psm_utils: - `psm_list = read_file(path, filetype="sage")` -* Build a peptidoform × run RT matrix (median aggregation), ignoring charge. -* Rank runs by summed pairwise overlap (# shared peptidoforms). -* Iteratively align runs (rank order) onto a growing reference scale using a - spline regression model (scikit-learn). -* Emit calibrated RT matrix + reference table + diagnostic table. -* Optional plots: - - run overlap bar chart - - per-alignment diagnostic plots - - before/after SD across runs -* Optional filtering by occurrence (%) and SD thresholds (absolute and/or - relative to gradient length). - -Outputs are written into the directory given by `--outdir`. - -Notes ------ -RT units are whatever Sage reports (often minutes). Ensure `--gradient-length` -uses the same units. -""" - -from __future__ import annotations - -import argparse -from dataclasses import dataclass -from pathlib import Path -from typing import Any, cast - -import numpy as np -import pandas as pd - - -# ------------------------- -# I/O (psm_utils -> DataFrame) -# ------------------------- - - -def load_psm_list(tsv_path: str | Path): - """Load Sage TSV results into a psm_utils PSMList.""" - - try: - from psm_utils.io import read_file - except ModuleNotFoundError as e: - raise ModuleNotFoundError( - "psm_utils is not installed. Install dependencies from requirements.txt and retry." - ) from e - - tsv_path = Path(tsv_path) - if not tsv_path.exists(): - raise FileNotFoundError(f"Input TSV not found: {tsv_path}") - - return read_file(str(tsv_path), filetype="sage") - - -def psm_list_to_long_df(psm_list) -> pd.DataFrame: - """Convert psm_utils PSMList into a long table with (run, peptidoform, rt). - - We ignore charge state by keeping only the string form of peptidoform/peptide. - """ - - rows: list[dict[str, Any]] = [] - for psm in psm_list: - run = ( - getattr(psm, "filename", None) - or getattr(psm, "run", None) - or getattr(psm, "spectrum_id", None) - ) - pep = ( - getattr(psm, "peptidoform", None) - or getattr(psm, "peptide", None) - or getattr(psm, "sequence", None) - ) - rt = getattr(psm, "retention_time", None) or getattr(psm, "rt", None) - - if run is None or pep is None or rt is None: - continue - - rows.append({"run": str(run), "peptidoform": str(pep), "rt": float(rt)}) - - long_df = pd.DataFrame(rows) - if long_df.empty: - raise ValueError( - "No usable PSM rows were extracted. Check that your Sage TSV contains RT and run identifiers " - "and that psm_utils mapped them correctly." - ) - return long_df - - -def build_rt_matrix(long_df: pd.DataFrame) -> pd.DataFrame: - """Pivot to peptidoform×run matrix of retention times (median aggregation).""" - - return long_df.pivot_table( - index="peptidoform", - columns="run", - values="rt", - aggfunc="median", - observed=True, - dropna=False, - ) - - -# ------------------------- -# Run overlap ranking -# ------------------------- - - -def rank_runs_by_overlap(rt_matrix: pd.DataFrame) -> pd.DataFrame: - """Rank runs by summed pairwise overlap (shared peptidoforms).""" - - present = rt_matrix.notna() - X = present.astype("uint8") - overlap = X.T.dot(X) # run x run - - scores = overlap.sum(axis=1) - pd.Series( - overlap.values.diagonal(), index=overlap.index - ) - n_peptidoforms = present.sum(axis=0) - avg_shared = scores / (len(overlap.index) - 1) if len(overlap.index) > 1 else scores - - run_ranking = ( - pd.DataFrame( - { - "run": overlap.index, - "overlap_score": scores.astype(int).values, - "avg_shared": avg_shared.values, - "n_peptidoforms": n_peptidoforms.loc[overlap.index].astype(int).values, - } - ) - .sort_values(["overlap_score", "n_peptidoforms"], ascending=False) - .reset_index(drop=True) - ) - run_ranking.insert(0, "rank", run_ranking.index + 1) - return run_ranking - - -# ------------------------- -# Alignment (spline regression) -# ------------------------- - - -def fit_calibration_model( - ref_df: pd.DataFrame, - run_series: pd.Series, - *, - n_knots: int = 12, - alpha: float = 1e-3, - min_overlap: int | None = None, -): - """Fit a spline model mapping rt_run -> rt_ref on overlapping peptidoforms.""" - - from sklearn.linear_model import Ridge - from sklearn.pipeline import make_pipeline - from sklearn.preprocessing import SplineTransformer - - merged = ref_df.merge( - run_series.rename("rt_run"), - left_on="peptidoform", - right_index=True, - how="inner", - ) - n_overlap = len(merged) - - required = max(50, n_knots * 5) if min_overlap is None else int(min_overlap) - if n_overlap < required: - raise ValueError( - f"Not enough overlap ({n_overlap}) to fit spline (required={required}, n_knots={n_knots})." - ) - - x = merged[["rt_run"]].to_numpy(dtype=float) - y = merged["rt_ref"].to_numpy(dtype=float) - - model = make_pipeline( - SplineTransformer(n_knots=n_knots, degree=3, include_bias=False), - Ridge(alpha=alpha), - ) - model.fit(x, y) - y_hat = model.predict(x) - mae = float(np.mean(np.abs(y - y_hat))) - - return model, merged, y_hat, mae - - -def calibrate_run(model, run_series: pd.Series) -> pd.Series: - """Apply a fitted model to calibrate a run's RTs onto the reference scale.""" - - run_all = run_series.dropna().astype(float) - x_all = run_all.to_numpy(dtype=float).reshape(-1, 1) - return pd.Series(model.predict(x_all), index=run_all.index, name="rt_cal") - - -def update_reference(ref_df: pd.DataFrame, rt_cal: pd.Series) -> pd.DataFrame: - """Weighted reference update with new calibrated RT series (weight=1 for the new run).""" - - out = ref_df.set_index("peptidoform").copy() - out = out.join(rt_cal, how="outer") - out["weight"] = out["weight"].fillna(0.0) - - has_ref = out["rt_ref"].notna() - has_new = out["rt_cal"].notna() - both = has_ref & has_new - only_new = (~has_ref) & has_new - - out.loc[both, "rt_ref"] = ( - out.loc[both, "rt_ref"] * out.loc[both, "weight"] + out.loc[both, "rt_cal"] - ) / (out.loc[both, "weight"] + 1.0) - out.loc[both, "weight"] = out.loc[both, "weight"] + 1.0 - - out.loc[only_new, "rt_ref"] = out.loc[only_new, "rt_cal"] - out.loc[only_new, "weight"] = 1.0 - - return out.drop(columns=["rt_cal"]).reset_index() - - -def maybe_plot_alignment( - x_run: np.ndarray, - y_ref: np.ndarray, - y_hat: np.ndarray, - *, - run_name: str, - rank: int, - max_points: int = 2000, -) -> None: - """Diagnostic plots for one alignment (subsamples if large).""" - - try: - import matplotlib.pyplot as plt - except ModuleNotFoundError: - return - - x_run = np.asarray(x_run, dtype=float) - y_ref = np.asarray(y_ref, dtype=float) - y_hat = np.asarray(y_hat, dtype=float) - - n = x_run.shape[0] - if n == 0: - return - - if n > max_points: - idx = np.random.default_rng(0).choice(n, size=max_points, replace=False) - x_run_s = x_run[idx] - y_ref_s = y_ref[idx] - y_hat_s = y_hat[idx] - else: - x_run_s, y_ref_s, y_hat_s = x_run, y_ref, y_hat - - order = np.argsort(x_run_s) - x_sorted = x_run_s[order] - yhat_sorted = y_hat_s[order] - - resid = y_ref_s - y_hat_s - - fig, axes = plt.subplots(1, 3, figsize=(15, 4)) - fig.suptitle(f"Alignment diagnostics (rank {rank}): {run_name}", y=1.05) - - axes[0].scatter(x_run_s, y_ref_s, s=6, alpha=0.35, label="overlap points") - axes[0].plot(x_sorted, yhat_sorted, color="black", linewidth=2, label="spline fit") - axes[0].set_xlabel("Run RT") - axes[0].set_ylabel("Reference RT") - axes[0].set_title("Overlap + fitted mapping") - axes[0].legend(loc="best", frameon=False) - - axes[1].scatter(x_run_s, resid, s=6, alpha=0.35) - axes[1].axhline(0, color="black", linewidth=1) - axes[1].set_xlabel("Run RT") - axes[1].set_ylabel("Ref - Pred") - axes[1].set_title("Residuals vs RT") - - axes[2].hist(resid, bins=40, color="#4C72B0", alpha=0.9) - axes[2].axvline(0, color="black", linewidth=1) - axes[2].set_xlabel("Residual") - axes[2].set_ylabel("Count") - axes[2].set_title("Residual distribution") - - plt.tight_layout() - plt.show() - - -@dataclass -class AlignmentResult: - run_ranking: pd.DataFrame - ref: pd.DataFrame - diag_df: pd.DataFrame - calibrated_matrix: pd.DataFrame - - -@dataclass -class AlignmentInputs: - """Convenience container for intermediate inputs/outputs. - - This is mainly useful when calling the library-style API. - """ - - long_df: pd.DataFrame - rt_matrix: pd.DataFrame - - -@dataclass -class AlignmentOutputs: - """Full outputs for programmatic use (includes intermediates).""" - - inputs: AlignmentInputs - result: AlignmentResult - - -def align_from_psm_list( - psm_list, - *, - n_knots: int = 12, - alpha: float = 1e-3, - min_overlap: int | None = None, - plot_diagnostics: bool = False, - plot_max_runs: int | None = 5, - make_sd_plot: bool = False, -) -> AlignmentOutputs: - """Run the full alignment pipeline starting from an in-memory PSMList. - - Parameters - ---------- - psm_list: - A psm_utils PSMList (or any iterable of PSM-like objects) with run id, - peptidoform/peptide, and retention time fields. - n_knots, alpha, min_overlap: - Spline calibration model hyperparameters. - plot_diagnostics, plot_max_runs: - If enabled, show per-run alignment diagnostic plots (requires matplotlib). - make_sd_plot: - If enabled, show the before/after SD plot after alignment. - - Returns - ------- - AlignmentOutputs - Includes the long table and raw RT matrix (inputs) and the alignment - outputs (run ranking, reference, diagnostics, calibrated matrix). - """ - - long_df = psm_list_to_long_df(psm_list) - rt_matrix = build_rt_matrix(long_df) - run_ranking = rank_runs_by_overlap(rt_matrix) - - if min_overlap == 0: - min_overlap = None - - result = align_runs( - rt_matrix, - run_ranking, - n_knots=int(n_knots), - alpha=float(alpha), - min_overlap=min_overlap, - plot_diagnostics=bool(plot_diagnostics), - plot_max_runs=plot_max_runs, - ) - - if make_sd_plot: - plot_sd_before_after(rt_matrix, result.calibrated_matrix) - - return AlignmentOutputs( - inputs=AlignmentInputs(long_df=long_df, rt_matrix=rt_matrix), - result=result, - ) - - -def align_runs( - rt_matrix: pd.DataFrame, - run_ranking: pd.DataFrame, - *, - n_knots: int = 12, - alpha: float = 1e-3, - min_overlap: int | None = None, - plot_diagnostics: bool = False, - plot_max_runs: int | None = 5, -) -> AlignmentResult: - """Iteratively align runs (rank order) onto a growing weighted reference.""" - - ranked_runs = run_ranking["run"].tolist() - if len(ranked_runs) < 2: - raise ValueError("Need at least 2 runs to start alignment.") - - def get_run_series(run_name: str) -> pd.Series: - return rt_matrix[run_name].dropna().astype(float) - - run1 = ranked_runs[0] - s1 = get_run_series(run1) - ref = pd.DataFrame({"peptidoform": s1.index, "rt_ref": s1.values, "weight": 1.0}) - - calibrated_rts: dict[str, pd.Series] = {str(run1): s1.rename("rt_cal")} - - diags: list[dict[str, Any]] = [] - for i, run_name in enumerate(ranked_runs[1:], start=2): - run_series = get_run_series(run_name) - model, merged, y_hat, mae = fit_calibration_model( - ref, - run_series, - n_knots=n_knots, - alpha=alpha, - min_overlap=min_overlap, - ) - y_hat = np.asarray(y_hat) - - if plot_diagnostics and (plot_max_runs is None or i <= plot_max_runs): - maybe_plot_alignment( - merged["rt_run"].to_numpy(), - merged["rt_ref"].to_numpy(), - y_hat, - run_name=str(run_name), - rank=i, - ) - - rt_cal = calibrate_run(model, run_series) - calibrated_rts[str(run_name)] = rt_cal - ref = update_reference(ref, rt_cal) - - diags.append( - { - "rank": i, - "run": str(run_name), - "n_overlap": int(len(merged)), - "mae_overlap": float(mae), - "n_run": int(run_series.shape[0]), - "ref_size": int(ref.shape[0]), - } - ) - - diag_df = pd.DataFrame(diags) - calibrated_matrix = pd.concat(calibrated_rts, axis=1) - calibrated_matrix.columns = calibrated_matrix.columns.astype(str) - - return AlignmentResult( - run_ranking=run_ranking, - ref=ref, - diag_df=diag_df, - calibrated_matrix=calibrated_matrix, - ) - - -# ------------------------- -# SD plots and filtering -# ------------------------- - - -def per_peptidoform_std(rt_df: pd.DataFrame, min_runs: int = 2) -> pd.Series: - n = rt_df.notna().sum(axis=1) - std = rt_df.std(axis=1, skipna=True) - std[n < min_runs] = np.nan - return std - - -def plot_sd_before_after( - rt_matrix: pd.DataFrame, calibrated_matrix: pd.DataFrame -) -> None: - """Plot per-peptidoform SD across runs before vs after calibration.""" - - try: - import matplotlib.pyplot as plt - except ModuleNotFoundError: - print("matplotlib not installed; skipping SD plots") - return - - raw_sd = per_peptidoform_std(rt_matrix) - cal_sd = per_peptidoform_std(calibrated_matrix) - cmp = pd.DataFrame({"raw_sd": raw_sd, "cal_sd": cal_sd}).dropna() - - print(f"Peptidoforms with SD in both (>=2 runs each): {cmp.shape[0]:,}") - print("Raw SD median:", float(cmp["raw_sd"].median())) - print("Cal SD median:", float(cmp["cal_sd"].median())) - print( - "Median fold-change (cal/raw):", float((cmp["cal_sd"] / cmp["raw_sd"]).median()) - ) - - fig, axes = plt.subplots(1, 3, figsize=(15, 4)) - fig.suptitle("Per-peptidoform RT variability across runs (SD)", y=1.05) - - axes[0].hist(cmp["raw_sd"], bins=60, alpha=0.75, label="raw", color="#DD8452") - axes[0].hist( - cmp["cal_sd"], bins=60, alpha=0.75, label="calibrated", color="#4C72B0" - ) - axes[0].set_xlabel("SD (RT units)") - axes[0].set_ylabel("Count") - axes[0].set_title("Histogram") - axes[0].legend(frameon=False) - - axes[1].set_title("ECDF") - for col, color in [("raw_sd", "#DD8452"), ("cal_sd", "#4C72B0")]: - x = np.sort(cmp[col].to_numpy()) - y = np.linspace(0, 1, x.size, endpoint=True) - axes[1].plot(x, y, label=col.replace("_", " "), color=color) - axes[1].set_xlabel("SD (RT units)") - axes[1].set_ylabel("Fraction ≤ x") - axes[1].legend(frameon=False) - - n = cmp.shape[0] - cmp_plot = cmp.sample(20000, random_state=0) if n > 20000 else cmp - axes[2].scatter(cmp_plot["raw_sd"], cmp_plot["cal_sd"], s=6, alpha=0.25) - lim = float(np.nanmax([cmp_plot["raw_sd"].max(), cmp_plot["cal_sd"].max()])) - axes[2].plot([0, lim], [0, lim], color="black", linewidth=1) - axes[2].set_xlabel("Raw SD") - axes[2].set_ylabel("Calibrated SD") - axes[2].set_title("Paired: raw vs calibrated") - - plt.tight_layout() - plt.show() - - -def filter_by_occurrence_and_sd( - rt_df: pd.DataFrame, - min_occurrence_pct: float = 50.0, - max_sd: float | None = None, - *, - gradient_length: float | None = None, - max_sd_rel: float | None = None, - min_runs: int = 2, - return_stats: bool = False, - keep: bool = True, - sd_ddof: int = 1, - verbose: bool = True, -) -> pd.DataFrame | tuple[pd.DataFrame, pd.DataFrame]: - """Filter a peptidoform×run RT matrix by occurrence (%) and SD thresholds. - - Supports two SD thresholds: - - Absolute: sd <= max_sd - - Relative-to-gradient: (sd / gradient_length) <= max_sd_rel - - If both SD gates are provided, both must pass. - """ - - if rt_df.shape[1] == 0: - raise ValueError("rt_df has no run columns.") - if not (0.0 <= float(min_occurrence_pct) <= 100.0): - raise ValueError("min_occurrence_pct must be between 0 and 100.") - if max_sd_rel is not None: - if gradient_length is None: - raise ValueError("gradient_length must be provided when max_sd_rel is set.") - if float(gradient_length) <= 0: - raise ValueError("gradient_length must be > 0.") - if float(max_sd_rel) < 0: - raise ValueError("max_sd_rel must be >= 0.") - if max_sd is not None and float(max_sd) < 0: - raise ValueError("max_sd must be >= 0.") - if int(min_runs) < 0: - raise ValueError("min_runs must be >= 0.") - - n_runs = int(rt_df.shape[1]) - n_obs = rt_df.notna().sum(axis=1).astype(int) - occurrence_pct = (n_obs / n_runs) * 100.0 - - sd = rt_df.std(axis=1, skipna=True, ddof=sd_ddof) - sd = sd.where(n_obs >= int(min_runs), np.nan) - - sd_rel = None - if gradient_length is not None: - sd_rel = sd / float(gradient_length) - - pass_occ = occurrence_pct >= float(min_occurrence_pct) - - pass_sd_abs = pd.Series(True, index=rt_df.index) - if max_sd is not None: - pass_sd_abs = sd.notna() & (sd <= float(max_sd)) - - pass_sd_rel = pd.Series(True, index=rt_df.index) - if max_sd_rel is not None: - if sd_rel is None: - raise ValueError("gradient_length must be provided when max_sd_rel is set.") - pass_sd_rel = sd_rel.notna() & (sd_rel <= float(max_sd_rel)) - - pass_sd = pass_sd_abs & pass_sd_rel - - pass_all = pass_occ & pass_sd - if not keep: - pass_all = ~pass_all - - filtered = rt_df.loc[pass_all].copy() - - stats_dict: dict[str, Any] = { - "occurrence_pct": occurrence_pct, - "n_obs": n_obs, - "sd": sd, - } - if sd_rel is not None: - stats_dict["sd_rel"] = sd_rel - stats = pd.DataFrame(stats_dict, index=rt_df.index) - - if verbose: - n_total = int(rt_df.shape[0]) - n_pass_occ = int(pass_occ.sum()) - n_pass_all = int((pass_occ & pass_sd).sum()) - print(f"Total peptidoforms: {n_total:,}") - print( - f"Pass occurrence >= {min_occurrence_pct:g}%: {n_pass_occ:,} ({n_pass_occ / max(n_total,1):.1%})" - ) - if max_sd is not None: - n_pass_abs = int(pass_sd_abs.sum()) - print( - f"Pass SD <= {max_sd:g} (min_runs={min_runs}): {n_pass_abs:,} ({n_pass_abs / max(n_total,1):.1%})" - ) - if max_sd_rel is not None: - n_pass_rel = int(pass_sd_rel.sum()) - gl = float(gradient_length) if gradient_length is not None else float("nan") - print( - f"Pass SD/gradient <= {max_sd_rel:g} (gradient_length={gl:g}, min_runs={min_runs}): " - f"{n_pass_rel:,} ({n_pass_rel / max(n_total,1):.1%})" - ) - print(f"Pass all gates: {n_pass_all:,} ({n_pass_all / max(n_total,1):.1%})") - - return (filtered, stats) if return_stats else filtered - - -# ------------------------- -# CLI glue -# ------------------------- - - -def parse_args(argv: list[str] | None = None) -> argparse.Namespace: - p = argparse.ArgumentParser(description=__doc__) - - p.add_argument( - "--input", - type=str, - default=str(Path(__file__).resolve().parent / "results.plasma_proteomics.tsv"), - help="Path to Sage results TSV (default: results.plasma_proteomics.tsv next to this script).", - ) - p.add_argument( - "--outdir", - type=str, - default=str(Path(__file__).resolve().parent / "out"), - help="Output directory (default: ./out).", - ) - - # Alignment model params - p.add_argument( - "--n-knots", type=int, default=12, help="Spline knots for calibration." - ) - p.add_argument( - "--alpha", type=float, default=1e-3, help="Ridge alpha for spline model." - ) - p.add_argument( - "--min-overlap", - type=int, - default=0, - help="Minimum overlap required to fit model (0 = auto heuristic).", - ) - - # Plotting - p.add_argument( - "--plots", action="store_true", help="Enable plots (requires matplotlib)." - ) - p.add_argument( - "--plot-max-runs", - type=int, - default=5, - help="Max number of per-alignment diagnostic plots to show (ignored if --plots is off).", - ) - - # Filtering - p.add_argument( - "--filter", - action="store_true", - help="Also produce a filtered calibrated matrix based on occurrence and SD gates.", - ) - p.add_argument( - "--min-occurrence-pct", - type=float, - default=0.0, - help="Filter: minimum occurrence percentage across runs.", - ) - p.add_argument( - "--max-sd", - type=float, - default=-1.0, - help="Filter: maximum absolute SD across runs (RT units). Use <0 to disable.", - ) - p.add_argument( - "--gradient-length", - type=float, - default=-1.0, - help="For relative SD filtering: gradient length in RT units. Use <0 to auto-estimate from calibrated RT range.", - ) - p.add_argument( - "--max-sd-rel", - type=float, - default=-1.0, - help="Filter: maximum SD/gradient_length (fraction). Use <0 to disable.", - ) - p.add_argument( - "--min-runs", - type=int, - default=2, - help="Filter: min runs observed to evaluate SD.", - ) - - p.add_argument( - "--no-write-long", - action="store_true", - help="Skip writing long_df parquet (saves disk).", - ) - - return p.parse_args(argv) - - -def main(argv: list[str] | None = None) -> int: - args = parse_args(argv) - in_path = Path(args.input) - outdir = Path(args.outdir) - outdir.mkdir(parents=True, exist_ok=True) - - min_overlap = None if int(args.min_overlap) <= 0 else int(args.min_overlap) - - print(f"Reading PSMs from: {in_path}") - psm_list = load_psm_list(in_path) - print(f"Loaded PSMs: {len(psm_list):,}") - - long_df = psm_list_to_long_df(psm_list) - rt_matrix = build_rt_matrix(long_df) - print(f"RT matrix shape (peptidoforms x runs): {rt_matrix.shape}") - - run_ranking = rank_runs_by_overlap(rt_matrix) - print("\nTop runs by overlap:") - print(run_ranking.head(10).to_string(index=False)) - - if args.plots: - try: - import matplotlib.pyplot as plt - - top = run_ranking.head(15).sort_values("overlap_score", ascending=True) - plt.figure(figsize=(10, 6)) - plt.barh(top["run"].astype(str), top["overlap_score"].astype(float)) - plt.title("Top runs by summed pairwise overlap") - plt.xlabel("Overlap score (sum of shared peptidoforms vs all other runs)") - plt.tight_layout() - plt.show() - except ModuleNotFoundError: - print("matplotlib not installed; skipping overlap plot") - - result = align_runs( - rt_matrix, - run_ranking, - n_knots=int(args.n_knots), - alpha=float(args.alpha), - min_overlap=min_overlap, - plot_diagnostics=bool(args.plots), - plot_max_runs=None if args.plot_max_runs is None else int(args.plot_max_runs), - ) - - print(f"\nCalibrated matrix shape: {result.calibrated_matrix.shape}") - - # Persist outputs - run_ranking_path = outdir / "run_ranking.tsv" - diag_path = outdir / "alignment_diagnostics.tsv" - ref_path = outdir / "reference.parquet" - cal_path = outdir / "calibrated_rts.parquet" - raw_path = outdir / "raw_rts.parquet" - - result.run_ranking.to_csv(run_ranking_path, sep="\t", index=False) - result.diag_df.to_csv(diag_path, sep="\t", index=False) - result.ref.to_parquet(ref_path) - result.calibrated_matrix.to_parquet(cal_path) - rt_matrix.to_parquet(raw_path) - - if not args.no_write_long: - long_df.to_parquet(outdir / "psms_long.parquet", index=False) - - print("\nWrote:") - print(f"- {run_ranking_path}") - print(f"- {diag_path}") - print(f"- {ref_path}") - print(f"- {cal_path}") - print(f"- {raw_path}") - if not args.no_write_long: - print(f"- {outdir / 'psms_long.parquet'}") - - if args.plots: - plot_sd_before_after(rt_matrix, result.calibrated_matrix) - - if args.filter: - max_sd = None if float(args.max_sd) < 0 else float(args.max_sd) - max_sd_rel = None if float(args.max_sd_rel) < 0 else float(args.max_sd_rel) - - if max_sd_rel is None: - gradient_length: float | None = None - else: - if float(args.gradient_length) < 0: - # Auto-estimate from calibrated RT range if user didn't provide one - s = result.calibrated_matrix.stack(dropna=True) - if len(s): - arr = s.to_numpy(dtype=float) - gradient_length = float(np.nanmax(arr) - np.nanmin(arr)) - else: - gradient_length = 0.0 - else: - gradient_length = float(args.gradient_length) - - filtered, stats = filter_by_occurrence_and_sd( - result.calibrated_matrix, - min_occurrence_pct=float(args.min_occurrence_pct), - max_sd=max_sd, - gradient_length=gradient_length, - max_sd_rel=max_sd_rel, - min_runs=int(args.min_runs), - return_stats=True, - verbose=True, - ) - - filtered = cast(pd.DataFrame, filtered) - stats = cast(pd.DataFrame, stats) - - filtered_path = outdir / "calibrated_rts.filtered.parquet" - stats_path = outdir / "calibrated_rts.filter_stats.tsv" - filtered.to_parquet(filtered_path) - stats.to_csv(stats_path, sep="\t") - - print("\nFiltered outputs:") - print(f"- {filtered_path}") - print(f"- {stats_path}") - - return 0 - - -if __name__ == "__main__": - psm_list = load_psm_list("results.plasma_proteomics.tsv") - - out = align_from_psm_list( - psm_list, - n_knots=12, - alpha=1e-3, - min_overlap=None, - plot_diagnostics=False, - make_sd_plot=False, - ) - - ref = out.result.ref - - filtered, stats = filter_by_occurrence_and_sd( - out.result.calibrated_matrix, - min_occurrence_pct=10, - gradient_length=ref["rt_ref"].max() - ref["rt_ref"].min(), - max_sd_rel=0.03, - min_runs=2, - return_stats=True, - verbose=True, - ) - - print(filtered.median(axis=1)) diff --git a/deeplc-todo/gui.py b/deeplc-todo/gui.py deleted file mode 100644 index 7e78c1e..0000000 --- a/deeplc-todo/gui.py +++ /dev/null @@ -1,404 +0,0 @@ -"""NiceGUI-based web interface for DeepLC.""" - -# TODO: Update to new API - -from __future__ import annotations - -import io -import logging -import tempfile -from pathlib import Path - -import pandas as pd -from nicegui import app, ui -from psm_utils.io import FILETYPES, read_file - -from deeplc import __version__ -from deeplc.calibration import PiecewiseLinearCalibration, SplineTransformerCalibration -from deeplc.core import predict, predict_and_calibrate - -logger = logging.getLogger(__name__) - - -def _get_file_format_options() -> dict[str, str]: - """Get file format options from psm_utils FILETYPES.""" - formats = {"auto": "Auto-detect"} - - # Add all formats that have readers - for filetype, properties in FILETYPES.items(): - if properties["reader"] is not None: - # Create friendly display names - display_name = filetype.replace("_", " ").title() - formats[filetype] = display_name - - return formats - - -class DeepLCGUI: - """DeepLC graphical user interface.""" - - def __init__(self): - self.prediction_file = None - self.calibration_file = None - self.results_df = None - self.use_calibration = False - self.calibration_type = "piecewise" - self.file_format = "auto" # Auto-detect by default - self.cal_file_format = "auto" - self.format_options = _get_file_format_options() - - self._build_ui() - - def _build_ui(self): - """Build the user interface.""" - # Header - with ui.header().classes("items-center justify-between"): - ui.label("DeepLC").classes("text-2xl font-bold") - ui.label(f"v{__version__}").classes("text-sm text-gray-400") - - # Main content - with ui.column().classes("w-full max-w-4xl mx-auto p-4 gap-4"): - # Info card - with ui.card().classes("w-full"): - ui.markdown( - """ - ### Deep Learning Retention Time Prediction - - Upload your peptide identification file (PSM file) to predict retention times. - Supports formats: MaxQuant, mzTab, Percolator, and more via psm_utils. - """ - ) - - # Input section - with ui.card().classes("w-full"): - ui.label("Input Files").classes("text-xl font-semibold mb-2") - - # Prediction file upload - ui.label("Peptide identification file (required)").classes("font-medium") - with ui.row().classes("w-full gap-2 items-start"): - self.pred_upload = ui.upload( - label="Choose file", - on_upload=self._handle_prediction_upload, - auto_upload=True, - ).classes("flex-grow") - ui.select( - label="Format", - options=self.format_options, - value="auto", - on_change=lambda e: setattr(self, "file_format", e.value), - ).classes("w-48") - self.pred_file_label = ui.label("No file selected").classes( - "text-sm text-gray-500" - ) # Calibration toggle - self.calibration_switch = ui.switch( - "Use calibration (requires observed retention times)", - on_change=self._toggle_calibration, - ).classes("mb-2") - - # Calibration file upload (hidden by default) - with ( - ui.column() - .classes("w-full") - .bind_visibility_from(self, "use_calibration") as self.calibration_section - ): - ui.label( - "Calibration file (optional - uses prediction file if not provided)" - ).classes("font-medium") - with ui.row().classes("w-full gap-2 items-start"): - self.cal_upload = ui.upload( - label="Choose calibration file", - on_upload=self._handle_calibration_upload, - auto_upload=True, - ).classes("flex-grow") - ui.select( - label="Format", - options=self.format_options, - value="auto", - on_change=lambda e: setattr(self, "cal_file_format", e.value), - ).classes("w-48") - self.cal_file_label = ui.label( - "Using prediction file for calibration" - ).classes("text-sm text-gray-500") - - # Calibration type selector - ui.label("Calibration method").classes("font-medium mt-2") - ui.radio( - ["piecewise", "spline"], - value="piecewise", - on_change=lambda e: setattr(self, "calibration_type", e.value), - ).props("inline").classes("mb-2") - ui.label( - "Piecewise: faster, good for linear relationships | " - "Spline: more flexible, better for complex patterns" - ).classes("text-xs text-gray-500") - - # Run button - with ui.row().classes("w-full justify-center"): - self.run_button = ( - ui.button( - "Predict Retention Times", - on_click=self._run_prediction, - icon="play_arrow", - ) - .classes("text-lg") - .props("color=primary size=lg") - ) - - # Results section - self.results_container = ui.column().classes("w-full") - - def _toggle_calibration(self, e): - """Toggle calibration section visibility.""" - self.use_calibration = e.value - - async def _handle_prediction_upload(self, e): - """Handle prediction file upload.""" - try: - # Store the file content as bytes - content = await e.file.read() - self.prediction_file = content - logger.info(f"Uploaded prediction file: {e.file.name}, size: {len(content)} bytes") - self.pred_file_label.set_text(f"✓ {e.file.name}") - self.pred_file_label.classes(replace="text-sm text-green-600") - ui.notify(f"File uploaded: {e.file.name}", type="positive") - except Exception as ex: - logger.exception("Error reading uploaded file") - self.pred_file_label.set_text(f"Error: {str(ex)}") - self.pred_file_label.classes(replace="text-sm text-red-600") - ui.notify(f"Error uploading file: {str(ex)}", type="negative") - - async def _handle_calibration_upload(self, e): - """Handle calibration file upload.""" - try: - content = await e.file.read() - self.calibration_file = content - logger.info(f"Uploaded calibration file: {e.file.name}, size: {len(content)} bytes") - self.cal_file_label.set_text(f"✓ {e.file.name}") - self.cal_file_label.classes(replace="text-sm text-green-600") - ui.notify(f"Calibration file uploaded: {e.file.name}", type="positive") - except Exception as ex: - logger.exception("Error reading calibration file") - self.cal_file_label.set_text(f"Error: {str(ex)}") - self.cal_file_label.classes(replace="text-sm text-red-600") - ui.notify(f"Error uploading calibration file: {str(ex)}", type="negative") - - async def _run_prediction(self): - """Run DeepLC prediction.""" - # Validation - logger.info(f"Run prediction clicked. prediction_file: {self.prediction_file is not None}") - if not self.prediction_file: - ui.notify("Please upload a peptide identification file", type="negative") - logger.warning("No prediction file uploaded") - return - - # Clear previous results - self.results_container.clear() - - # Show progress - with self.results_container: - progress_card = ui.card().classes("w-full") - with progress_card: - ui.label("Running DeepLC...").classes("text-lg font-semibold") - spinner = ui.spinner(size="lg") - - try: - # Parse input files - logger.info("Reading prediction file...") - file_format = None if self.file_format == "auto" else self.file_format - - # psm_utils requires a file path, so write to temp file - with tempfile.NamedTemporaryFile(mode="wb", delete=False, suffix=".psm") as tmp_file: - tmp_file.write(self.prediction_file) - tmp_pred_path = tmp_file.name - - try: - psm_list = read_file(tmp_pred_path, filetype=file_format) - finally: - Path(tmp_pred_path).unlink(missing_ok=True) - - if self.use_calibration: - # Determine calibration source - if self.calibration_file: - logger.info("Reading calibration file...") - cal_format = None if self.cal_file_format == "auto" else self.cal_file_format - - # Write calibration file to temp file - with tempfile.NamedTemporaryFile( - mode="wb", delete=False, suffix=".psm" - ) as tmp_file: - tmp_file.write(self.calibration_file) - tmp_cal_path = tmp_file.name - - try: - psm_list_cal = read_file(tmp_cal_path, filetype=cal_format) - finally: - Path(tmp_cal_path).unlink(missing_ok=True) - else: - logger.info("Using prediction file for calibration...") - psm_list_cal = psm_list - - # Select calibration method - if self.calibration_type == "spline": - calibration = SplineTransformerCalibration() - else: - calibration = PiecewiseLinearCalibration(number_of_splits=50) - - # Run with calibration - logger.info("Running prediction with calibration...") - predictions = await self._run_in_background( - predict_and_calibrate, - psm_list=psm_list, - psm_list_reference=psm_list_cal, - calibration=calibration, - ) - else: - # Run without calibration - logger.info("Running prediction without calibration...") - predictions = await self._run_in_background(predict, psm_list=psm_list) - - # Prepare results DataFrame - self.results_df = pd.DataFrame( - { - "peptidoform": [psm.peptidoform.proforma for psm in psm_list], - "predicted_rt": predictions, - } - ) - - # Add observed RT if available - observed_rts = [ - psm.retention_time for psm in psm_list if psm.retention_time is not None - ] - if observed_rts and len(observed_rts) == len(psm_list): - self.results_df["observed_rt"] = observed_rts - - # Clear progress and show results - progress_card.delete() - self._show_results() - - except Exception as e: - logger.exception("Error during prediction") - progress_card.delete() - with self.results_container: - with ui.card().classes("w-full bg-red-50"): - ui.label("Error").classes("text-xl font-semibold text-red-600") - ui.label(str(e)).classes("text-red-800") - - async def _run_in_background(self, func, **kwargs): - """Run prediction function in background to avoid blocking UI.""" - import asyncio - - loop = asyncio.get_event_loop() - return await loop.run_in_executor(None, lambda: func(**kwargs)) - - def _show_results(self): - """Display prediction results.""" - with self.results_container: - # Success message - with ui.card().classes("w-full bg-green-50"): - ui.label("✓ Prediction Complete").classes("text-xl font-semibold text-green-600") - ui.label(f"Predicted retention times for {len(self.results_df)} peptides").classes( - "text-green-800" - ) - - # Results table - with ui.card().classes("w-full"): - ui.label("Results Preview").classes("text-xl font-semibold mb-2") - - # Create columns for the table - columns = [ - {"name": col, "label": col.replace("_", " ").title(), "field": col} - for col in self.results_df.columns - ] - - # Convert DataFrame to list of dictionaries for the table - rows = self.results_df.to_dict("records") - - # Display paginated table - ui.table( - columns=columns, - rows=rows, - row_key="peptidoform", - pagination={"rowsPerPage": 10, "sortBy": None, "descending": False}, - ).classes("w-full") - - # Plot if observed RT is available - if "observed_rt" in self.results_df.columns: - with ui.card().classes("w-full"): - ui.label("Observed vs Predicted").classes("text-xl font-semibold mb-2") - self._plot_correlation() - - # Download button - with ui.card().classes("w-full"): - ui.label("Download Results").classes("text-xl font-semibold mb-2") - csv_data = self.results_df.to_csv(index=False) - ui.button( - "Download CSV", - on_click=lambda: ui.download(csv_data.encode(), "deeplc_predictions.csv"), - icon="download", - ).props("color=primary") - - def _plot_correlation(self): - """Plot observed vs predicted retention times using Plotly.""" - import numpy as np - import plotly.graph_objects as go - - # Calculate metrics - observed = self.results_df["observed_rt"].values - predicted = self.results_df["predicted_rt"].values - mae = np.mean(np.abs(observed - predicted)) - r2 = np.corrcoef(observed, predicted)[0, 1] ** 2 - - # Create scatter plot - fig = go.Figure() - - fig.add_trace( - go.Scatter( - x=observed, - y=predicted, - mode="markers", - name="Predictions", - marker=dict(size=5, opacity=0.5, color="blue"), - hovertemplate="Observed: %{x:.2f}
Predicted: %{y:.2f}", - ) - ) - - # Add diagonal line - min_val = min(observed.min(), predicted.min()) - max_val = max(observed.max(), predicted.max()) - fig.add_trace( - go.Scatter( - x=[min_val, max_val], - y=[min_val, max_val], - mode="lines", - name="y=x", - line=dict(color="red", dash="dash", width=2), - ) - ) - - fig.update_layout( - title=f"Retention Time Prediction Performance (R² = {r2:.3f}, MAE = {mae:.2f})", - xaxis_title="Observed RT", - yaxis_title="Predicted RT", - hovermode="closest", - height=500, - showlegend=True, - ) - - ui.plotly(fig).classes("w-full") - - -def start_gui(host: str = "127.0.0.1", port: int = 8080, reload: bool = False): - """Start the DeepLC NiceGUI interface.""" - DeepLCGUI() - - ui.run( - host=host, - port=port, - title="DeepLC - Retention Time Prediction", - reload=reload, - favicon="🧬", - ) - - -if __name__ in {"__main__", "__mp_main__"}: - start_gui() diff --git a/examples/deeplc_example.py b/examples/deeplc_example.py deleted file mode 100644 index 2a44b2b..0000000 --- a/examples/deeplc_example.py +++ /dev/null @@ -1,78 +0,0 @@ -# Imports -import pandas as pd -from matplotlib import pyplot as plt - -from deeplc import DeepLC, FeatExtractor - -if __name__ == "__main__": - # Input files - peptide_file = "examples/datasets/dia.csv" - - # Read the input data to make predictions for - df = pd.read_csv(peptide_file, sep=",") - - # Unmodified peptides in modifications column should be empty strings, not nan - df = df.fillna("") - - # Generate some identifiers, any kind of identifiers will do - df.index = ["Pep_" + str(dfi) for dfi in df.index] - - # Make a feature extraction object. - # This step can be skipped if you want to use the default feature extraction - # settings. In this example we will use a model that does not use RDKit features - # so we skip the chemical descriptor making procedure. - - # f_extractor = FeatExtractor(chem_descr_feat=False,verbose=False) - f_extractor = FeatExtractor( - add_sum_feat=False, - ptm_add_feat=False, - ptm_subtract_feat=False, - standard_feat=False, - chem_descr_feat=False, - add_comp_feat=False, - cnn_feats=True, - verbose=True, - ) - # Initiate a DeepLC instance that will perform the calibration and predictions - dlc = DeepLC( - path_model=[ - "deeplc/mods/full_hc_hela_hf_psms_aligned_1fd8363d9af9dcad3be7553c39396960.hdf5", - "deeplc/mods/full_hc_hela_hf_psms_aligned_8c22d89667368f2f02ad996469ba157e.hdf5", - "deeplc/mods/full_hc_hela_hf_psms_aligned_cb975cfdd4105f97efa0b3afffe075cc.hdf5", - "deeplc/mods/full_hc_PXD005573_mcp_cb975cfdd4105f97efa0b3afffe075cc.hdf5", - ], - cnn_model=True, - f_extractor=f_extractor, - verbose=True, - write_library=True, - use_library="deeplc/library/library.csv", - ) - - df["tr"] = list(range(len(df.index))) - - # To demonstrate DeepLC's callibration, we'll induce some an artificial - # transformation into the retention times - df["tr"] = df["tr"] ** 0.85 - - # Calibrate the original model based on the new retention times - dlc.calibrate_preds(seq_df=df) - - print("a") - - # Make predictions; calibrated and uncalibrated - preds_cal = dlc._make_preds(seq_df=df) - - print("b") - - preds_uncal = dlc._make_preds(seq_df=df, calibrate=False) - - print("c") - - # Compare calibrated and uncalibrated predictions - # print("Predictions (calibrated): ", preds_cal) - # print("Predictions (uncalibrated): ", preds_uncal) - - plt.scatter(df["tr"], preds_cal, label="Calibrated", s=1) - plt.scatter(df["tr"], preds_uncal, label="Uncalibrated", s=1) - plt.legend() - plt.savefig("deeplc_calibrated_vs_uncalibrated.png") diff --git a/scripts/onnx_model.py b/scripts/onnx_model.py deleted file mode 100644 index bef6e9b..0000000 --- a/scripts/onnx_model.py +++ /dev/null @@ -1,31 +0,0 @@ - -import os -from tensorflow.keras.models import load_model -import tensorflow as tf -import tf2onnx -from onnx2torch import convert -import torch - -deeplc_dir = os.path.dirname(os.path.realpath(__file__)) -DEFAULT_MODELS = [ - "mods/full_hc_PXD005573_pub_1fd8363d9af9dcad3be7553c39396960.keras", - "mods/full_hc_PXD005573_pub_8c22d89667368f2f02ad996469ba157e.keras", - "mods/full_hc_PXD005573_pub_cb975cfdd4105f97efa0b3afffe075cc.keras", -] -DEFAULT_MODELS = [os.path.join(deeplc_dir, dm) for dm in DEFAULT_MODELS] -def _convert_to_onnx(): - for model_path in DEFAULT_MODELS: - if os.path.exists(model_path): - mod = load_model(model_path) - spec = [ - tf.TensorSpec([None, 60, 6], tf.float32, name="input_1"), - tf.TensorSpec([None, 30, 6], tf.float32, name="input_2"), - tf.TensorSpec([None, 55], tf.float32, name="input_3"), - tf.TensorSpec([None, 60, 20], tf.float32, name="input_4"), - ] - onnx_model, _ = tf2onnx.convert.from_keras(mod, input_signature=spec, opset=13) - torch_model = convert(onnx_model) - torch.save(torch_model, model_path.replace(".keras", ".pt")) - -if __name__ == "__main__": - _convert_to_onnx() \ No newline at end of file diff --git a/streamlit/.dockerignore b/streamlit/.dockerignore deleted file mode 100644 index f4bf89e..0000000 --- a/streamlit/.dockerignore +++ /dev/null @@ -1,5 +0,0 @@ -.dockerignore -Dockerfile -__pycache__/ -.venv/ -deeplc_library.txt diff --git a/streamlit/.streamlit/config.toml b/streamlit/.streamlit/config.toml deleted file mode 100644 index 71d187e..0000000 --- a/streamlit/.streamlit/config.toml +++ /dev/null @@ -1,19 +0,0 @@ -[client] -showErrorDetails = false - -[runner] -magicEnabled = false - -[server] -fileWatcherType = "none" -headless = true - -[browser] -gatherUsageStats = false - -[theme] -primaryColor="#763737" -backgroundColor="#FFFFFF" -secondaryBackgroundColor="#f2f2f2" -textColor="#262730" -font="sans serif" diff --git a/streamlit/Dockerfile b/streamlit/Dockerfile deleted file mode 100644 index 583ae9a..0000000 --- a/streamlit/Dockerfile +++ /dev/null @@ -1,7 +0,0 @@ -FROM python:3.10-slim-buster -COPY . /deeplc -WORKDIR /deeplc -RUN pip install --upgrade pip && pip install -r requirements.txt -ENV DEEPLC_LIBRARY_PATH="/tmp/deeplc_library.txt" -EXPOSE 8501 -CMD ["streamlit", "run", "deeplc_streamlit.py"] diff --git a/streamlit/README.md b/streamlit/README.md deleted file mode 100644 index 4fca34f..0000000 --- a/streamlit/README.md +++ /dev/null @@ -1,22 +0,0 @@ -# DeepLC Streamlit-based web server - - -## Usage - -Pull and run with - -```sh -docker run -p 8501 ghcr.io/compomics/deeplc-streamlit -``` - -Streamlit can be further configured using environment variables: - -```sh -docker run \ - -p 8501 \ - -e STREAMLIT_SERVER_MAX_UPLOAD_SIZE=200 \ - ghcr.io/compomics/deeplc-streamlit -``` -See -[Streamlit configuration](https://docs.streamlit.io/en/stable/streamlit_configuration.html) -for more info. diff --git a/streamlit/deeplc_streamlit.py b/streamlit/deeplc_streamlit.py deleted file mode 100644 index fcd574d..0000000 --- a/streamlit/deeplc_streamlit.py +++ /dev/null @@ -1,430 +0,0 @@ -"""Streamlit-based web interface for DeepLC.""" - -import logging -import os -import pathlib -from datetime import datetime -from importlib.metadata import version - -import pandas as pd -import plotly.express as px -from streamlit_utils import hide_streamlit_menu, save_dataframe - -import streamlit as st -from deeplc import DeepLC - -logger = logging.getLogger(__name__) - - -class DeepLCStreamlitError(Exception): - pass - - -class MissingPeptideCSV(DeepLCStreamlitError): - pass - - -class InvalidPeptideCSV(DeepLCStreamlitError): - pass - - -class InvalidCalibrationPeptideCSV(DeepLCStreamlitError): - pass - - -class MissingCalibrationPeptideCSV(DeepLCStreamlitError): - pass - - -class MissingCalibrationColumn(DeepLCStreamlitError): - pass - - -class StreamlitUI: - """DeepLC Streamlit UI.""" - - def __init__(self): - """DeepLC Streamlit UI.""" - self.texts = WebpageTexts - self.user_input = dict() - - self._set_library_path() - - st.set_page_config( - page_title="DeepLC web server", - page_icon=":rocket:", - layout="centered", - initial_sidebar_state="expanded", - ) - - hide_streamlit_menu() - - self._main_page() - self._sidebar() - - def _main_page(self): - """Format main page.""" - st.title("DeepLC") - st.header("Input and configuration") - - with st.form(key="main_form"): - st.subheader("Input files") - self.user_input["input_csv"] = st.file_uploader( - "Peptide CSV", help=self.texts.Help.peptide_csv - ) - self.user_input["input_csv_calibration"] = st.file_uploader( - "Calibration peptide CSV (optional)", - help=self.texts.Help.calibration_peptide_csv, - ) - self.user_input["use_example"] = st.checkbox( - "Use example data", help=self.texts.Help.example_data - ) - - with st.expander("Info about peptide CSV formatting"): - st.markdown(self.texts.Help.csv_formatting) - - st.subheader("Calibration") - self.user_input["calibration_source"] = st.radio( - "Calibration peptides", - [ - "Use calibration peptide CSV", - "Use `tr` column in peptide CSV", - "Do not calibrate predictions", - ], - help=self.texts.Help.calibration_source, - ) - with st.expander("Set advanced calibration options"): - self.user_input["dict_cal_divider"] = st.number_input( - "Dictionary divider", - step=1, - value=100, - help=self.texts.Help.dict_cal_divider, - ) - self.user_input["split_cal"] = st.number_input( - "Split calibration", - step=1, - value=25, - help=self.texts.Help.split_cal, - ) - - st.subheader("Prediction speed boost") - self.user_input["use_library"] = st.checkbox( - "Use prediction library for speed-up", - help=self.texts.Help.use_library, - ) - st.markdown(self.texts.Help.use_library_agreement) - - submit_button = st.form_submit_button("Predict retention times") - - if submit_button: - try: - self._run_deeplc() - except MissingPeptideCSV: - st.error(self.texts.Errors.missing_peptide_csv) - except MissingCalibrationPeptideCSV: - st.error(self.texts.Errors.missing_calibration_peptide_csv) - except MissingCalibrationColumn: - st.error(self.texts.Errors.missing_calibration_column) - except InvalidPeptideCSV: - st.error(self.texts.Errors.invalid_peptide_csv) - except InvalidCalibrationPeptideCSV: - st.error(self.texts.Errors.invalid_calibration_peptide_csv) - - def _sidebar(self): - """Format sidebar.""" - st.sidebar.image( - "https://github.com/compomics/deeplc/raw/master/img/deeplc_logo.png", - width=150, - ) - st.sidebar.markdown(self.texts.Sidebar.badges) - st.sidebar.header("About") - st.sidebar.markdown(self.texts.Sidebar.about, unsafe_allow_html=True) - - def _run_deeplc(self): - """Run DeepLC given user input, and show results.""" - # Parse user config - config = self._parse_user_config(self.user_input) - use_lib = self.user_input["use_library"] - calibrate = isinstance(config["input_df_calibration"], pd.DataFrame) - - logger.info( - "Run requested // %s // peptides %i / use_library %r / calibrate %r", - datetime.now(), - len(config["input_df"]), - use_lib, - calibrate, - ) - - # Run DeepLC - st.header("Running DeepLC") - status_placeholder = st.empty() - status_placeholder.info(":hourglass_flowing_sand: Running DeepLC...") - try: - dlc = DeepLC( - dict_cal_divider=self.user_input["dict_cal_divider"], - split_cal=self.user_input["split_cal"], - use_library=self.library_path if use_lib else "", - write_library=True if use_lib else False, - reload_library=True if use_lib else False, - ) - if calibrate: - config["input_df_calibration"]["modifications"].fillna("", inplace=True) - dlc.calibrate_preds(seq_df=config["input_df_calibration"]) - config["input_df"]["modifications"].fillna("", inplace=True) - preds = dlc.make_preds(seq_df=config["input_df"], calibrate=calibrate) - except Exception as e: - status_placeholder.error(":x: DeepLC ran into a problem") - st.exception(e) - else: - status_placeholder.success(":heavy_check_mark: Finished!") - - # Add predictions to input DataFrame - result_df = config["input_df"] - result_df["predicted_tr"] = preds - - # Show head of result DataFrame - st.header("Results") - st.subheader("Selection of predicted retention times") - st.dataframe(result_df.head(100)) - - # Plot results - self._plot_results(result_df) - - # Download link - st.subheader("Download predicted retention times") - st.download_button( - label="Download", - data=save_dataframe(result_df), - file_name="deeplc_predictions.csv", - mime="text/csv", - ) - - def _set_library_path(self): - if "DEEPLC_LIBRARY_PATH" in os.environ: - try: - pathlib.Path(os.environ["DEEPLC_LIBRARY_PATH"], exist_ok=True).touch() - self.library_path = os.environ["DEEPLC_LIBRARY_PATH"] - except OSError: - self.library_path = "deeplc_library.txt" - else: - self.library_path = "deeplc_library.txt" - - @staticmethod - def get_example_input(): - """Return example DataFrame for input.""" - if os.path.isfile("example_data.csv"): - example_df = pd.read_csv("example_data.csv") - else: - example_df = pd.DataFrame( - [ - ["AAGPSLSHTSGGTQSK", ""], - ["AAINQKLIETGER", "6|Acetyl"], - ["AANDAGYFNDEMAPIEVKTK", "12|Oxidation|18|Acetyl"], - ], - columns=["seq", "modifications"], - ) - return example_df - - def _parse_user_config(self, user_input): - """Validate and parse user input.""" - config = { - "input_filename": None, - "input_df": None, - "input_df_calibration": None, - } - - # Load example if use_example was selected - if user_input["use_example"]: - config["input_filename"] = "example.csv" - config["input_df"] = self.get_example_input() - config["input_df_calibration"] = config["input_df"] - return config - - # Get peptide dataframe - if user_input["input_csv"]: - config["input_filename"] = user_input["input_csv"].name - try: - config["input_df"] = pd.read_csv(user_input["input_csv"]) - except (ValueError, pd.errors.ParserError) as e: - raise InvalidPeptideCSV(e) from e - else: - raise MissingPeptideCSV - - # Get calibration peptide dataframe - if user_input["calibration_source"] == "Use `tr` column in peptide CSV": - if "tr" not in config["input_df"].columns: - raise MissingCalibrationColumn - else: - config["input_df_calibration"] = config["input_df"] - elif user_input["calibration_source"] == "Use calibration peptide CSV": - if not user_input["input_csv_calibration"]: - raise MissingCalibrationPeptideCSV - else: - try: - config["input_df_calibration"] = pd.read_csv( - user_input["input_csv_calibration"] - ) - except (ValueError, pd.errors.ParserError) as e: - raise InvalidPeptideCSV(e) from e - - return config - - @staticmethod - def _plot_results(result_df): - """Plot results with Plotly Express.""" - if "tr" in result_df.columns: - st.subheader("Input retention times vs predictions") - fig = px.scatter( - result_df, - x="tr", - y="predicted_tr", - hover_data=["seq", "modifications"], - trendline="ols", - opacity=0.25, - color_discrete_sequence=["#763737"], - ) - fig.update_traces(marker=dict(size=4)) - fig.update_layout( - xaxis_title_text="Input retention time", - yaxis_title_text="Predicted retention time", - ) - else: - st.subheader("Predicted retention time distribution") - fig = px.histogram( - result_df, - x="predicted_tr", - marginal="rug", - opacity=0.8, - histnorm="density", - color_discrete_sequence=["#763737"], - ) - fig.update_layout( - xaxis_title_text="Predicted retention time", - yaxis_title_text="Density", - bargap=0.2, - ) - st.plotly_chart(fig, use_container_width=True) - - -class WebpageTexts: - class Sidebar: - badges = """ - [![GitHub release](https://img.shields.io/github/release-pre/compomics/deeplc.svg?style=flat-square)](https://github.com/compomics/deeplc/releases) - [![GitHub](https://img.shields.io/github/license/compomics/deeplc.svg?style=flat-square)](https://www.apache.org/licenses/LICENSE-2.0) - [![Twitter](https://img.shields.io/twitter/follow/compomics?style=flat-square)](https://twitter.com/compomics) - """ - - about = f""" - DeepLC is a retention time predictor for (modified) peptides that employs - Deep Learning. Its strength lies in the fact that it can accurately predict - retention times for modified peptides, even if hasn't seen said modification - during training. - - DeepLC can be run with a - [graphical user interface](https://github.com/compomics/DeepLC#graphical-user-interface), - as a [Python package](https://github.com/compomics/DeepLC#python-package) - (both CLI and Python API), or through this web application. - - If you use DeepLC for your research, please use the following citation: - >**DeepLC can predict retention times for peptides that carry as-yet unseen - modifications**
- >Robbin Bouwmeester, Ralf Gabriels, Niels Hulstaert, Lennart Martens, Sven Degroeve
- >_Nature Methods 18, 1363–1369 (2021)_
- >[doi:10.1038/s41592-021-01301-5](https://doi.org/10.1038/s41592-021-01301-5) - - --- - - Currently using the following package versions:
- [![DeepLC](https://img.shields.io/badge/deeplc-{version("deeplc")}-blue?style=flat-square&logoColor=white&logo=pypi)](https://github.com/compomics/deeplc) - [![Tensorflow](https://img.shields.io/badge/tensorflow-{version("tensorflow")}-blue?style=flat-square&logoColor=white&logo=pypi)](https://github.com/tensorflow/tensorflow) - [![Streamlit](https://img.shields.io/badge/streamlit-{version("streamlit")}-blue?style=flat-square&logoColor=white&logo=pypi)](https://github.com/streamlit/streamlit) - - Latest DeepLC version:
- ![PyPI](https://img.shields.io/pypi/v/deeplc?style=flat-square&logoColor=white&logo=pypi) - """ - - class Help: - peptide_csv = """CSV with peptides for which to predict retention times. Click - below on _Info about peptide CSV formatting_ for more info. - """ - calibration_peptide_csv = """CSV with peptides with known retention times to be - used for calibration. Click below on _Info about peptide CSV formatting_ for - more info. - """ - example_data = "Use example data instead of uploaded CSV files." - csv_formatting = """ - DeepLC expects comma-separated values (CSV) with the following columns: - - - `seq`: Unmodified peptide sequences - - `modifications`: MS²PIP-style formatted peptide modifications: Each - modification is listed as `location|name`, separated by a pipe (`|`) between - the location, the name, and other modifications. `location` is an integer - counted starting at 1 for the first AA. `0` is reserved for N-terminal - modifications, `-1` for C-terminal modifications. `name` has to correspond - to a Unimod (PSI-MS) name. All supported modifications are listed on - [GitHub](https://github.com/compomics/DeepLC/blob/master/deeplc/unimod/unimod_to_formula.csv) - - `tr`: Retention time (only required for calibration CSV) - - For example: - - ```csv - seq,modifications,tr - AAGPSLSHTSGGTQSK,,12.1645 - AAINQKLIETGER,6|Acetyl,34.095 - AANDAGYFNDEMAPIEVKTK,12|Oxidation|18|Acetyl,37.3765 - ``` - - See - [examples/datasets](https://github.com/compomics/DeepLC/tree/master/examples/datasets) - for more examples. - """ - calibration_source = """DeepLC can calibrate its predictions based on set of - known peptide retention times. Calibration also ensures that the - best-fitting DeepLC model is used. - """ - dict_cal_divider = """This parameter defines the precision to use for - fast-lookup of retention times for calibration. A value of 10 means a - precision of 0.1 (and 100 a precision of 0.01) between the calibration - anchor points. This parameter does not influence the precision of the - calibration, but setting it too high results in mean that there is bad - selection of the models between anchor points. A safe value is usually - higher than 10. - """ - split_cal = """The number of splits for the chromatogram. If the value is set - to 10 the chromatogram is split up into 10 equidistant parts. For each part - the median value of the calibration peptides is selected. These are the - anchor points. Between each anchor point a linear model is fit. - """ - use_library = """DeepLC can fetch previously predicted retention times from a - library, instead predicting retention times for the same (modified) peptide - again. This feature will not change any of the predicted retention time - values. It can, however, significantly speed up DeepLC. - """ - use_library_agreement = """_By selecting this box, you allow us to store the - uploaded peptide sequences and modifications on this server indefinitely._ - """ - - class Errors: - missing_peptide_csv = """ - Upload a peptide CSV file or select the _Use example data_ checkbox. - """ - missing_calibration_peptide_csv = """ - Upload a calibration peptide CSV file or select another _Calibration - peptides_ option. - """ - missing_calibration_column = """ - Upload a peptide CSV file with a `tr` column or select another _Calibration - peptides_ option. - """ - invalid_peptide_csv = """ - Uploaded peptide CSV file could not be read. Click on _Info about peptide - CSV formatting_ for more info on the correct input format. - """ - invalid_calibration_peptide_csv = """ - Uploaded calibration peptide CSV file could not be read. Click on _Info - about peptide CSV formatting_ for more info on the correct input format. - """ - - -if __name__ == "__main__": - StreamlitUI() diff --git a/streamlit/example_data.csv b/streamlit/example_data.csv deleted file mode 100644 index eeafc19..0000000 --- a/streamlit/example_data.csv +++ /dev/null @@ -1,1367 +0,0 @@ -seq,modifications,tr -VSLDDLQQSIEEDEDHVQSTDIAAMQK,,15083.4 -NVIAETGAGQHGVATATACAK,,6098.04 -FATVPTGGASSAAAGAAGAAAGGDAAEEEK,,8934.060000000001 -LTPAANQVEIHPLLPQDELINFCK,,15085.800000000001 -DAGAISGLNVLRIINEPTAAAIAYGLGAGK,,15405.0 -FALAGAIGCGSTHSSMVPIDVVK,,13898.88 -IPAVEYFGGESPVDVQSQVDSSSVSEDSAVFK,,15257.16 -ATVDEFPLCVHLVSNELEQLSSEALEAARICANK,,15430.56 -AANSVSQDSSYTDFSFTIAGTAHNAHSVTQSASK,,11014.800000000001 -LVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYAR,,13282.019999999999 -FIAEGSNMGSTPEAIAVFETARSTATGPSEAVWYGPPK,,15313.26 -EISEDGADSLNVAMDCISEAFGFEREAVSGILGK,,15451.44 -NMITGTSQADCAILIIAGGVGEFEAGISK,,15436.68 -RAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK,,14474.28 -GVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPK,,15435.48 -AIEMEGLTWGAHQFIPIGFGIK,,15368.34 -AASELRILYGGSANGSNAVTFK,,11455.44 -LGTPSEDTVSAAATANNISTMGDESRK,,9801.900000000001 -TVPFVPISGWNGDNMIEATTNAPWYK,,15372.060000000001 -ISAVSTYFESFPYRVNPETGIIDYDTLEK,,15331.619999999999 -SSYGSSSNDDSYGSSNNDDSYGSSNK,,4800.768 -IEVLEQELVRAEAESLVAEAQLSNITRSK,,15362.22 -SINPDEAVAYGAAVQGAILTGQSTSDETK,,15245.22 -EPNRSINPDEAVAYGAAVQAAILTGDESSK,,15301.02 -SLEYRIIHYDDPSQQLVNTDLDILNNTRAK,,14799.48 -TDTSSSSSSSSASSVSAHQPTQEK,,3464.7960000000003 -VGVQVAAQHNTSVFYGLPQEK,,10565.22 -ELDNSSTISTHDASTNGLINQFK,,10771.5 -SVEMHHEQLEQGVPGDNVGFNVK,,9161.52 -LPLVGGHEGAGVVVGMGENVK,,11390.4 -DGNVGNFNETEQILLAENPESEK,,13930.98 -TEPSEAETTTVNTESLGQAEHEIK,,8812.74 -EAVESADLILSVGALLSDFNTGSFSYSYK,,15478.619999999999 -DEIVLSGNSVEDVSQNAADLQQICR,,13751.699999999999 -LQNTSNSTDAGELFNAQNAGYK,,9458.58 -EVYEGEVTELTPEDAENPLGGYGK,,13126.74 -GNYPINAVTTMAETAVIAEQAIAYLPNYDDMRNCTPK,,15447.78 -HDVPQDSNDNNNEELEAQGQQAQEK,,4989.24 -SLSLEEVEGHLFEIIDEASK,,15426.839999999998 -AYTSSAQVMPEVPQHEPSTTQEFNVDELSNELK,,13857.24 -GYVTDMQHYQEMYQQSINEPEK,,11769.36 -IYEVEGMRWAGNANELNAAYAADGYAR,,13295.22 -HDSVEEAWLCDIDEAVIRLSK,,15416.46 -QGNEGNIASNYITQVPLQK,,11325.72 -HCPSSTYVICNDTNLSK,,6661.38 -VASNEAEQLGDLTTLANPEVVPAIISAVENQFFSQK,,15488.52 -NEDACSFTLYGDGASNQGQVFESFNMAK,,15056.039999999999 -LYDIASGQTQQIGMHSAPIK,,9836.039999999999 -HQVDLSGSGTNNMGSNGAPK,,4970.298000000001 -LEILSHEGSVVETIDMRNK,,11184.3 -TEILANEQGNRITPSYVAFTDDERLIGDAAK,,13566.12 -KNEETDLPVSGLFYAIGHTPATK,,14813.7 -TNEAAGDGTTSATVLGRAIFTESVK,,13008.66 -EAYNYNDEQYQAISLVNYNVEK,,13294.08 -YNIFATTSGGGPTGQAESIMHAIAK,,15274.199999999999 -WIGGHGTTIGGIIVDSGK,,11505.12 -EHAPYTDELEEDVYLDPLARVSK,,14108.22 -NHGNVEGYGLDWSPLIK,,13184.820000000002 -EADNSTSYYIAGHATTVIDGK,,9829.5 -IGSSSAVAQFAAHSDPSVQIEQDK,,10250.04 -HQVCTPGGTTIAGLCVMEEK,,10228.8 -HLNICGTVGSIDNDMSTTDATIGAYSALDRICK,,15013.14 -PTGPGGAASHLPNAMNK,,5913.546 -YSVPIVANGRDLMACAQTGSGK,,11346.18 -VAETALFSGNDGADSNPGDSAQVEEHK,,8554.5 -PQGSIEHLQSGVYYLTNIDDK,,12592.62 -NGTDGTLNVAVDACQAAAHSHHFMGVTK,,10520.76 -YDNIPEHAFYMVGGIEDVVAK,,15324.3 -ELVARVQGGEEVNAEELK,,8477.34 -HALPFEGMLPDFGSPVIEGTK,,15347.52 -TTNDTYEATYAIPMHCENCVNDIK,,10349.58 -IGSGSFGDIYHGTNLISGEEVAIK,,13652.94 -HGFMSSNGDYDGANRFMGSK,,8446.8 -LDYENVPSVIFSHPEAGSIGISEK,,14682.42 -IEETHEDDMVTIDGVQVHLSTFNK,,13033.26 -GLSLLDFTSSDNNYMTQVHDYK,,15121.98 -KAEETISWLDSNTTASK,,9040.619999999999 -LPDAVVACVGGGSNSTGMFSPFEHDTSVK,,14010.72 -TVIFTHGVEPTVVVSSK,,10186.02 -QYLITQNGSIQGLPNVPQELK,,13877.640000000001 -YVNDLSHDETVLLDQRK,,9604.5 -PTYNPYTEPSMEIFSWHEGLQK,,14935.68 -EHDEIEEQGDALQDVEESSEK,,9184.98 -PTSTTETVAASAVAAVFEQK,,15294.9 -IATYQERDPANLPWGSSNVDIAIDSTGVFK,,15299.820000000002 -SADEVINMANDSEYGLAAGIHTSNINTALK,,14079.24 -TQTDRTNIDNSTGQAGQANAQSANTVNNRVNNNSK,,4847.628000000001 -GQVVGSIIALDRQEVVSTDDK,,11666.82 -STSGNTHLGGQDFDTNLLEHFK,,13057.08 -YSGVCHTDLHAWHGDWPLPVK,,11740.26 -GEVVDGTVVSCSQHGFEVQVGPMK,,11490.06 -LSDDIPPSAPMAINCEYGSFDNEHVVLPRTK,,12976.68 -LTGAQDAMGHPVQEIESLCMNCGK,,12539.16 -GIEAAGGSADIYQVEETLSPEVVK,,14746.86 -ATNPNGNLSYDATSTLTLPGHELPLPK,,13560.72 -AGPVVTDNNNFIIDADFGEISDPRK,,14525.460000000001 -HSPDFSAFDACHNGASFFK,,11664.84 -IYEVEGMRWAGNANELNAAYAADGYARIK,,13766.699999999999 -PVTVHCDHLIQAQVGGEK,,6772.14 -DNAEGQGESLADQARDYMGAAK,,11202.9 -LEDVSITHMTFGPEFTK,,13307.34 -ISHVSTGGGASLELLEGK,,9450.84 -SHLQSNQLYSNQLPLDFALGK,,14111.039999999999 -QITVVGATSGDTGSAAIYGLRGK,,10409.94 -SQLLYSHSLAHELAEYCEAK,,11278.14 -VHSGSEQLANASEDTK,,3702.672 -LAVVPQGGNTDLVGASVPVFDEIVLSLRNMNK,,15436.68 -QVEDEDHMEVFPAGSSFPSTK,,10858.8 -AVVESVGAEVDEARINELLSSLEGK,,15356.1 -SSYGSNNDDSYGSNNDDSYGSSNK,,4829.082 -SIVTLDVKPWDDETNLEEMVANVK,,15340.199999999999 -VESTYGHNVSAVEEASVVLLGTK,,14387.82 -SPLTEQSTEYASISNNSDQTIAFK,,11566.14 -PSYYLDPEAAAAGAAAVANQGK,,13273.56 -LSETVLEDVYNQLPELIGGSADLTPSNLTRWK,,15403.800000000001 -LYGTDDNTQEVEAVTNK,,8005.14 -SSYGSSNNDSYGSNNDDSYGSSNK,,4622.682000000001 -EEAAPKPPSSAVFSMFGGK,,12660.66 -ESVANANTDGFDFNLLTINSEHK,,14570.04 -VSISHDDLQAVAVAVSTK,,11486.1 -QDHYGGEAASVTLSQLYEK,,10651.32 -TPCGTVGYTAPEVVK,,7796.7 -RSVSEIEIESVQDQPSVAVGSFFK,,14606.94 -EAIYGEPDHVITVDVVMDNLK,,15245.22 -CIYDQLTEGENSLCGVMIESNINEGRQDIPK,,15255.9 -EHGEPLFSSHMLDLSEETDEENISTCVK,,13493.58 -VYVVATHGIFTGDCLEELEK,,13874.460000000001 -HLNTSCELVNSLMHLSPEDK,,14066.76 -RIDTLAAEFPAQTNYLYTTYNATK,,14280.36 -RLGQEFADDDGELVSAADIVPIVQEK,,15270.06 -GPIYNDQNMVISDSGYLLSK,,13851.54 -MVSQLESSLLNCPDSLDADSPCLYTK,,14770.92 -FNQNETDILASTGSDNSIVLYDLRTNSPTQK,,14203.56 -GLGVGTPSEALLYVITSPVGPYYK,,15408.720000000001 -LTNMPFGGNPTANQSGSGNSLFGTK,,12609.539999999999 -IFVGNSHPELGNMVCQRLGIEPAPCTLK,,13318.5 -GQYLVCMDADLQHPPETVPK,,11370.78 -QGAGSATLSMAFAGAK,,9999.42 -HGADCLEANQDVDSPIWTPSK,,10136.76 -AAAEGVANLHLDEATGEMVSK,,10328.58 -YSSSGTPENITGEADDEDEDIIRNSYGQMIK,,12838.5 -VEGAVGNLGNAVTVTEDGTVVTVVSTAK,,15266.039999999999 -SLATSGDSLGAVQLLTTDPPYSADAPTK,,14781.18 -EPVSDWTDDVEARINFGIEK,,15266.039999999999 -NSDVWFLDHNYIENMNEMCK,,15229.56 -ELYGNIVMSGGTTMFPGIAERMQK,,15283.92 -FDSSVDRGSPFQCNIGVGQVIK,,12057.0 -NYENGFINNPIVISPTTTVGEAK,,13975.619999999999 -IEACGVCGSDIHCAAGHWGNMK,,8505.9 -GSGVAMAMYNTDESIEGFAHSSFK,,14636.460000000001 -YLYENNMLHGNTMTVTGDTLAERAK,,10940.460000000001 -FGLPHADDVLGLPIGQHIVIK,,15299.820000000002 -ELESAAYDHAEPVQPEDAPQDIANDELK,,10986.78 -NVNYAFVEYHQSHDANIALQTLNGK,,11810.64 -DTTPLMADDVADLIVYATSRK,,15414.84 -ENVFIVSPYNHTNLPTVTPTYIK,,14260.74 -GHFQYCFLNENTGIETK,,10707.48 -QFANSNNNNNDSGNNNQGDYVTK,,4825.902 -PVDEADNEDMIATIK,,9590.1 -VACQLIMRGLSGEYK,,10601.699999999999 -FEDTLDNIIQSCQPNAIGINGPNPK,,14487.54 -ATIQVYEETAGLTVGDPVLRTGK,,13018.86 -LIVDPMDAPDQPQDLTIDFERGLPVK,,15331.619999999999 -AIMPIIEGHDVLAQAQSGTGK,,12374.400000000001 -RITSIDQLPEWNFDGSSTNQAPGHDSDIYLK,,13982.640000000001 -GQLTPAQVYNYYPDLTNAHFK,,13307.34 -IGPVVAFTHNSTGPFVTQNK,,11271.6 -GVEEVEGEYELTEAVEDGPRPFK,,12837.54 -EVIQNYGDDGYVFSTGGGIVESAESRK,,12632.220000000001 -NGPNPTSSLEIINIDVGTNTLK,,14930.1 -LAAVPAAGPASAGGAAAASGDAAAEEEK,,8299.26 -FVEPPTTFSLSDLTIIPRVK,,15352.44 -ASDIMHDQGPVNTEDWLTK,,11496.18 -TLVSGNALVDIEPIYGPTYLPRK,,15096.54 -ELDLARPIYLPTASYGHFTNQEYSWEK,,14893.380000000001 -ILPEPTEGFAADDEPTTPAELVGK,,13751.039999999999 -KYETDCPLNTAVITPLK,,10744.68 -IPVLEQELVRAEAESLVAEAQLSNITREK,,15373.26 -NAVSTKPTPPPAPEASAESGLSSK,,6530.22 -LSDDIPPSAPMAINCEYGSFDNEHVVLPR,,14209.32 -NLYVGQEDNEMTIPTCSRSGDIIEPLLK,,14697.960000000001 -DESDAISHINTQSPYIYFK,,13028.16 -FCQEHDILVEAYSPLGPLQK,,13957.26 -HEIDATVAQGVEISK,,7748.4 -VYHIDESLIDDPQECADNYEK,,11235.78 -TYQGTEDVSDARSAITSAQELLDSK,,14287.14 -NWDSGCVEETGAVYPFGADK,,12507.6 -IITHEGLDAATVAGWSTK,,10671.72 -PGDHVIALYTAECGK,,8195.82 -TADNNSMPHGAVSSYAK,,5040.87 -IWCFGPDGNGPNLVIDQTK,,14671.14 -VFQVGNIVHPSVVVSNDEENNELVR,,13054.380000000001 -YNLPNGGPAPESVTNAIWEASK,,14309.22 -HVVFGEVVDGYDIVK,,12546.66 -DHGEGGIIVGSALENK,,8575.74 -GILFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIK,,15273.720000000001 -PVSAFHDIPLYADK,,10921.32 -DGSDTCTSNLAPAYPISPVDNFNTHINVPHQFISK,,14465.16 -DQVALRMPELIPVLSETMWDTK,,15406.26 -NLDDSVDDEKLEEEFAPYGTITSAK,,14030.1 -LSDVYDLHFSPAGNYLSTWER,,15297.359999999999 -EHWSETTVAYQLPK,,9383.16 -HCLVNGLDDIGITLQK,,12981.54 -VDQCNTMFDFNDPSFDIQGK,,14737.2 -SISSNTHGFDLGADTK,,7318.9800000000005 -TCNVLVAIEQQSPDIAQGLHYEK,,14714.820000000002 -LTQNQEHTEENEVDATAK,,4211.994 -YSSSSDAASADDSTPLRDNDEAGNEK,,5450.118 -VFSLDPQYLVDDLRPEFAGYSK,,15365.880000000001 -SHDVVIIGGGPAGYVAAIK,,12107.039999999999 -CLTDDCDTITAFPPGHVYDSK,,11129.58 -ISSFEADNGPAWLQFCEK,,14552.46 -EPVVGVIYNPHINLLVSASK,,14642.28 -EYGADELFDYHDADVIEQIK,,14814.3 -LEDNSASMITNSISDLHITGENNVK,,13881.900000000001 -FTLEPTLIATLAELDVTVPINSDDVK,,15455.16 -HFNDFETPHPVVTIESK,,9622.86 -LVGYVSAGTVEYLYSHDDGK,,12619.5 -DYCDGFSYGCPPHAGGGIGLER,,11000.64 -EIQSVASETLISIVNAVNPVAIK,,15448.98 -MVSYISGNYDTDEGFDELRTQIEK,,13942.019999999999 -NENAVSTDTSTPAAAGAPEGKPPQK,,5121.414 -PVSIASYNHLGNNDGYNLSAPK,,10014.42 -IVDTNGAGDAFAGGFMAGLTK,,14874.119999999999 -HFNDYDFVSAENADDDFK,,11333.7 -NPTGNTVVMQPQFK,,8081.339999999999 -EAIDALNGMLLNGQEIYVAPHLSRK,,15110.52 -CSMASRIDNYSEEPSNVFGSVLK,,13145.16 -QPLESASNNNGQSLFVK,,8751.06 -HLAGGLVNVLNGANQPVPEDLIK,,14731.08 -LNDAEDRVVVCATIDNLLK,,15299.820000000002 -CGNADVVVAGGCESMTNAPYYMPAARAGAK,,10806.900000000001 -HGAVHLSTYLK,,5825.9400000000005 -YIASGENHCFALTK,,7057.56 -TAGIQIVADDLTVTNPK,,12588.48 -DVPANASFNLEDPNIDFERVILNAVESLK,,15465.0 -ALRQLPTILADNAGFDSSELVSK,,14376.6 -DLRQLDANSSTTALDALNK,,11274.0 -PEENALTDEEK,,4514.4 -QLVGETISDANMNTLAGGK,,10942.44 -IAGCSPNISVNVGDFTK,,11566.14 -VESHLLNMSQDDLASK,,8746.2 -FTTEQLEAFNHQFESSNFTAR,,13447.44 -QSISDAELLLSSTIK,,14721.960000000001 -VSDGSSEIFFK,,10040.34 -TLPLDDLIAHLK,,15351.240000000002 -VQGSVIGIDLGTTNSAVAIMEGK,,15320.64 -NGNEYNEFLYSK,,9075.84 -AIGALASNNSGVDEHNQILNK,,7998.18 -DYEAAIELRENAHLK,,9192.66 -SPILHWNEFQALK,,12613.5 -TDAQAPTTGFSFGSQLGGNK,,10954.68 -TFQLEPSMFGLEEHELSK,,14715.84 -KPLESYDEDNK,,3707.382 -ITSSQVREHVK,,3572.034 -IIENAEGSRTTPSVVAFTK,,8747.82 -PAFSFGAKPDEK,,6880.8 -WFGWPGLEIPDDEK,,15394.02 -FNNQFEPCAGNITNYLLEK,,14952.300000000001 -YLNDNQREILLNYGGEK,,9950.82 -ITADTQAVTHAAFLSMGSAWAK,,14383.62 -AQAQVEVAQQEYDYYNDLLK,,14092.26 -ELDTAQKHIDAGAK,,3877.476 -FRAPEALFHPSVLGLESAGIDQTTYNSIMK,,15308.4 -FDDVDGKPLVEK,,6476.28 -PQDFQVDYSSEK,,7087.08 -QVLVASSEVLYAEAADEK,,12291.3 -LSICGEESFGTGSNHIREK,,7405.4400000000005 -LVEDPQVIAPFLGK,,14446.2 -ARIMADDYGWDVTDARK,,9335.460000000001 -DYPINSFYSIDLNK,,14460.480000000001 -YGSANVEGTILK,,7966.200000000001 -HSWNYDENFPNEVDPDQK,,9816.3 -HMDYDGNIVK,,5516.358 -TEQPFYDLSLHLK,,13022.039999999999 -PLLDASGVDPREEDK,,8013.839999999999 -NQRAPTAAELQAPPPPPSSTK,,6436.68 -GVIYDCPNSRLMEQK,,7740.539999999999 -PVTAPLPDIEGQTNEGQIGLMK,,13496.880000000001 -QLIEDVQLSRPLAK,,10087.14 -VSSNVQQPQQQLGDMENNLEK,,9814.98 -NPEDLNIWTSTK,,10723.14 -TGLQCRLCGNDHMTMNCPFK,,8905.02 -TFDEHNAPNSNSNK,,3196.488 -WASQMNNIQPTLFPDHNAK,,11553.9 -ISQDTGAFIEETK,,7778.280000000001 -VIVTSSTAALVTPTDMNK,,10597.26 -SLQDIIAILGMDELSEQDK,,15444.060000000001 -FVQGLLQNAAANAEAKGLDATK,,12610.74 -LLDAVDEYIPTPERDLNK,,13369.08 -GAHAAFVPTLLEAAYK,,13315.86 -LGGTPLETRSTADDSLNNSYK,,7580.82 -CCMVTSSWQVFDK,,12298.14 -NTRETAQAINGWELTK,,8613.119999999999 -GHLIIENAPLIEEVK,,12237.119999999999 -TDVVDSTNLPILELLSLK,,15452.7 -LYGENVTIPMLNPK,,13407.84 -FSGNDTFQTFYK,,10667.220000000001 -ISGAMTNAIFK,,9687.06 -YEYEVHANFK,,6805.56 -VPANEIEAISSPLMGIFEK,,15398.94 -QTEIAQHIFTK,,7122.24 -TGDGDIENIPYGVLVWATGNAPREVSK,,15362.22 -EDIIANNAIEEIDRNLNK,,13948.56 -WGFTNLDRPEYLK,,12278.46 -EYVPLDNAEQSTSSSQETK,,7159.62 -TIAETLAEELINAAK,,15413.579999999998 -IEVQTLQNLTNTLDEQETETK,,14006.58 -QDLPEAMSAAEITEK,,10367.28 -HYAGDVTYDIDGITDK,,9849.78 -PQNDYIERHIK,,4839.858 -TVPYLNSNRNVASYLQSNSSQEK,,10385.58 -ETNPGTDVTVSSVESVLAHL,,15416.46 -FANILESATLNTVQQDGIMTK,,15287.640000000001 -QFGGQHDASRVFLCNSGTEANEAALK,,9281.039999999999 -YFTSVSQQQFAVIK,,11476.259999999998 -DHDANFSSELK,,5716.553999999999 -ELEDQHHVVVK,,3979.9979999999996 -IIQHVALPWDAPCPWDESK,,14361.0 -PVFQDLYESTK,,10401.12 -EPADDYVLEASIK,,10609.44 -FLEDLGYTYHDETDNTVYQK,,11638.92 -APLVIADPTYFPEK,,12762.9 -GLGNPLLYDGVERVSLQDIK,,14511.42 -AGGVVEATVCYSGDMLQPGK,,12097.56 -DIGGSSSTTDFTNEIINK,,11537.94 -VSIGTDAVYAAEK,,8379.48 -LDAPSSPHACPGK,,4114.23 -NPSTLDDHVLAK,,5845.434 -ETCRQLGLGTNIYNAER,,8634.36 -NLKHIDVTFTK,,6666.78 -LYTDSGLIYPPK,,10250.4 -IEAALSDALAALQIEDPSADELRK,,15340.199999999999 -HFLETVVENLK,,12740.58 -VLAESNVSYAEESSSHNVLLLQRFPISEAQK,,13532.46 -IAPAGYLVTGSWSQK,,11712.960000000001 -AFTSYDRTLLIADSRRPEPK,,8807.76 -IADISLAAFGRK,,10630.92 -HEDLVNSIESK,,6279.900000000001 -NQWGNYGFYPVTVGSASK,,13045.619999999999 -VGGVVLGYEGLK,,10330.92 -ESGTHHIDGQAIYDK,,4559.742 -DVDGFGPTNIGELNK,,11659.32 -HAVSEGTRAVTK,,2626.116 -EELYIRPPPHLGMNDK,,9618.6 -HLQLAIRNDDELNK,,7005.54 -GTGVVTCVPSNSPDDYITTK,,9773.46 -KEDIVSNINESK,,5054.910000000001 -STSPAANSADTPNETGK,,3439.662 -ELGLTVVTDEAIEQMRK,,14657.640000000001 -FALMRLGDDYQPPATEGLSGNESLVEK,,14246.94 -VNGLQDIFQIAK,,14781.84 -AHYCGTPYLAK,,5113.374 -QSFTRVGENNLTCISCFQPVLNK,,12898.86 -NGAGDDDGVEGSTPK,,3465.816 -TVLFLPGFDHAGIATQSVVEK,,14955.96 -LGYHFGPSDAEAVMAPK,,11013.36 -NLSDETTSQAFQEPK,,7581.36 -ADVDGFLVGGASLKPEFVDIINSRN,,15336.54 -LLTIFDSVDESARIK,,13555.74 -ALEMVSDSTRETVLK,,8812.74 -APSLFGGMGQTGPK,,10003.86 -PSDPTTAQPQTLK,,4771.326 -KKEEEEQLSEEDAK,,3159.6059999999998 -TMLDASMGEILVTLEK,,15407.519999999999 -EQFSDGVGYSWIDGLK,,14878.14 -AEGATGGLVPHK,,4350.39 -IDANTNNINHVK,,4194.24 -LGGEVFIDFTK,,13501.98 -LSQYSIDEDDDIENRMVMPK,,11336.699999999999 -DDIATVERLLTDSSK,,14872.08 -STLNDGIAANFDGISK,,11241.18 -RFLNPDAMLLMETEGMNQASNPK,,14897.880000000001 -HALIVYDDLSK,,8763.84 -NQTASSLTIEDPAITFTHDK,,11410.44 -EANEPTVDDVADRK,,5092.584 -IPYFNAPIYLENK,,14128.08 -EFQSDLTHQLATTVLK,,13147.08 -AVRLEATDYATRAWPGGVGDK,,10244.64 -THGAPTDEVRHVGDMGNVK,,5717.3099999999995 -LVGPTAEVIGAVSGGVDSTVASK,,14324.1 -LVEEDDMHTFNEWFAK,,13968.960000000001 -LDPSTPVSLINDPRHPYGK,,10366.98 -AISSDQLFGRGSFDEAANREAHDK,,8908.92 -IADQATENVADISNLK,,9695.7 -YFRGSELQNYFTK,,10270.32 -INPDDRIDILGLAELAPGK,,15327.960000000001 -IEELQYDSTLSLPSSEFSK,,13529.58 -ASYPVYVSEYDDVK,,10060.5 -LLQAVFSRVMNASDDK,,13140.84 -PNWDEELPK,,9013.62 -DRPNWGYGTPATGVGK,,7684.800000000001 -MIVPTYGDVLDASNRIK,,13070.1 -NAVSVDMSHFEWAK,,11749.199999999999 -FESYDPVTGTYSYTIDHPVLT,,14337.779999999999 -FYSTQIEELPSDIATLLN,,15429.3 -CTGGIILTASHNPGGPENDMGIK,,9928.62 -KFENLPDLISFK,,14100.599999999999 -TLVGHSGTVYSTSFSPDNK,,7903.02 -ICSGSTTISESQTFK,,6611.5199999999995 -TLTTVQGVPEEYDLK,,10451.16 -IGLDCASSEFFK,,12388.32 -WLYGDSEAESFNVNFTHK,,13068.36 -LNDMSNALLSLNACPMSQVK,,14564.16 -PMCVEAFSEYPPLGRFAVR,,14928.18 -ETIARVTGGMK,,4901.67 -LIAHSVATYADSFEGFPK,,12525.06 -HCTISSDTDSDSGNAK,,2779.536 -PTLETMETVK,,7215.0 -YDHEASSSYK,,2624.64 -IVSEGPAHTGAK,,2999.7360000000003 -AILESVGIEIEDEK,,12924.720000000001 -NVPQGIAVTRYHSLAGTESSLPSCLK,,10718.7 -FGFSGFPVTEDGK,,12869.64 -NLSLLAEEVVDNIVNK,,15433.019999999999 -NILAESNSSLDNIVK,,11633.039999999999 -WLQNEGIPAVYGVDTRSLTK,,13082.039999999999 -NARTFLVSGVAANVHEAK,,8061.78 -RFGLEGLESVVPGIK,,14769.48 -EDGHLEDGLSK,,4453.956 -AEWGSDIPTTK,,7647.96 -GEDSRMYSTSNYSISLVDLENGPK,,13054.380000000001 -ADEGIFTPGVGGGGIGIVK,,13372.92 -VIITGAPAAFSPTCTVSHIPGYINYLDELVK,,15391.560000000001 -VDHFLANEAK,,4898.316 -VIWPTFHYILNPSNEGEQEK,,14972.640000000001 -NANLNNSRNANAPGEAGHQNK,,2955.498 -NVACVLNFDLPTTAK,,13983.84 -TVVAEYAIAQSLK,,11216.82 -FSGTVSSDVFK,,8696.4 -LPNCPRPNMSICIFGDAFDVDRAK,,14486.58 -SIIGERLLQSTQGIPSYIVSSK,,15121.74 -TIATSDNSPYCGIVHETK,,7427.58 -RTDNLDELVQASGFSK,,11702.640000000001 -LTLSDSSTPLTEDLIK,,13638.539999999999 -LDIFDDNAAHLK,,10388.64 -YDAIVKPTTDK,,4859.5380000000005 -LWIDEPFNLDFDPRDVIK,,15397.679999999998 -DSSVLEFDSIEEIPNERK,,12884.16 -YGPVHVVNLLSTK,,10512.359999999999 -PVDDENVILNK,,7202.04 -SYELPDGQVITIGNER,,12901.74 -TLSGNDYINASYVK,,9111.12 -VVGASVVVVK,,6846.54 -SSIEDLNHPLAVEINNIAGVK,,14638.5 -NFDSARPAGQNK,,3211.806 -DLNQEGDDQMFVRK,,7494.4800000000005 -GSQAMVMVEEK,,6284.1 -ITELGLEHEPLRLYWNK,,13054.08 -ELLSLNSQIGELSIENENLK,,15244.14 -FEENCAHSWIK,,6911.4 -SQEVEYVDPTVNRVPNYEVSEK,,9678.9 -SNDDEDLLLTADDSTRLK,,10702.980000000001 -PSQCQICQSK,,2993.73 -HCEYYQCGK,,3211.806 -EHLTFNWPEFK,,13305.42 -SNEFDSAIIQSVQGDSNLVTK,,14184.720000000001 -SHVDINMSTIK,,6660.48 -TAPVSSTAGPQTASTSK,,3843.276 -FDMSLQQDEENNELEAGEK,,10568.16 -ELGAGHYALVK,,6764.219999999999 -EEPEQEEIAPSLPSRNSIPAPK,,9710.1 -ITIQLTRDVEPENLQVTSEK,,11465.04 -LIGNFTLAGIPPAPK,,14351.1 -TSGYADRTAEFK,,4771.062 -QAQLTAATNAK,,3708.582 -FSLNTEYQANPETELINLK,,14548.8 -NSPSDFNKPDLPELIQRLNK,,13323.06 -VAGFSGGLVVDDPESK,,10529.34 -RLENFITNTFRK,,9685.26 -PTLYTDIEIPQLK,,14358.18 -DIYRENNGDITAFWK,,12637.019999999999 -ETGSTENTENNELQSRDDK,,3601.44 -LGEADDGAGTTDEDYMAWK,,10946.1 -NPNWLEEYHPK,,8834.1 -MSASDDTTAIFMTDTPK,,11503.26 -ALDADVVSIEFSK,,12569.820000000002 -ALYDTFSVFGDILSSK,,15435.48 -DEIRASVNEASK,,4412.382 -TLDEFGRSIAVGK,,9013.62 -SFRPPYSDAYVGVRQDSGDPVEYTK,,10155.9 -SLNHPENEPSSVK,,3664.668 -TFTNVGGQNLNNAK,,6076.14 -NNSTTTGNGPNNINNK,,2874.594 -DATESVAVEPSNEDVKPEEK,,6337.5 -HEATFELPQPDK,,7895.579999999999 -PIDSFNEVLTHHLEVIK,,13416.66 -QAPIAANESTIVSEWSK,,11786.64 -VVADDLVLVTPK,,11516.220000000001 -APYNISSLASEYALK,,13516.32 -AGIQNNDPINYGK,,6535.5 -DAVSVFGFRTQFGGGK,,13248.9 -YAGEVSHDDK,,2396.076 -PLFHSAILETSAK,,9384.3 -ADEVDYFHEEDRFFEK,,11794.08 -VLSVLQNAGFDDERDFK,,12131.34 -WTNQLTESASHFEQYTK,,10884.3 -SYNENQCVIISGESGAGK,,7087.08 -NNELHILDEQSK,,7270.5 -EWLVENHPDELK,,9020.76 -FDNLYGCRESLVDGIK,,10859.64 -NIVLHDYDLADK,,8825.64 -SPMPQNNTLGGENK,,4928.712 -GPDSYFLINHPAYVK,,11091.36 -EDDVRDFVIR,,9229.619999999999 -RGQVVSEEQRPGTPLFTVK,,7859.28 -LQNNEMDPEPVEEFQDDIK,,12283.68 -ALAYMGLEPNTPLK,,11895.3 -DLTNSHLVNEVPK,,7919.820000000001 -ESLGTHGYFK,,5762.622 -SNSHDLGYVK,,3888.264 -AYLPVNESFGFTGELR,,14632.92 -FRFDLNEDAMATEK,,11170.68 -AVPHYNRLDSYK,,5242.638 -PSETPATIVK,,5193.33 -STLINVLTGELLPTSGEVYTHENCRIAYIK,,15340.199999999999 -GQHLADILNSASRVPESNK,,9784.199999999999 -ALHISGNKPESNPEK,,3776.676 -ECDIVFSGLDADYAGAIEK,,14757.6 -EEFEHNFIGEESLPLDK,,12319.380000000001 -SLVVDSEGQIRYAK,,7944.24 -KDEDEEADEDMK,,2970.132 -SANHTLTDELTTATTNTNGDK,,7957.74 -HEAYLSILMDRQTK,,10284.539999999999 -NFNGNAEDSSTAGNTTHTEYQK,,4474.056 -QTEQLEAQVLQVNK,,9114.0 -HSNVVAGVGGASLNVLK,,9469.800000000001 -AGLLGVESIELTPHIISK,,14822.34 -SSFGEDALANLCIEK,,13265.939999999999 -YANEVRSQVFAQHPDK,,5705.1720000000005 -SALLEHFNTEDFK,,10714.859999999999 -QVILGYENDARPILYLK,,13395.599999999999 -PFSYQEPLPK,,8650.44 -WDDLNEQLTLLSK,,14109.48 -NSGGNNNTTDLK,,2508.198 -RGDVVAMTGDGVNDAPALK,,8556.900000000001 -DIYDDTERELAFYK,,13487.16 -FELGRQPANTK,,4946.316 -SGIINGVEEAARVASQLGQK,,15290.04 -QAATSVSATASK,,2870.37 -ENDQYDTLDVGHYCEK,,8213.58 -EVGITAVHVK,,5983.4039999999995 -TNFVSQHPSSYYAK,,6080.7 -VASANATAAESDVAK,,4488.455999999999 -YEGSGLSAVTRK,,4830.486 -QAALYNAAEDLDRDFFK,,15123.119999999999 -RLGDTLYEEFGISK,,12962.880000000001 -EQEEEVDDEVVNDMFGGK,,13156.08 -YGFAGFPVTTDGK,,11929.08 -ERLNVYFNEASSGK,,7921.32 -STTTMGLVQALTAHLGK,,15304.74 -SLEQIVNEYSTFSENK,,14606.94 -ASNTDVNVISWSDK,,9732.9 -SVLYHEGVRSQFSK,,5780.25 -TSMPYLISHMPSLIEK,,15281.52 -RRTFTTCADNQTTVQFPVYQGERVNCK,,8626.86 -FSHSLQFNSVPEWSTK,,11201.460000000001 -NGSEVEMITLNNIRVSMNK,,13128.18 -LPPHTQIFQAGTK,,6782.28 -VIDNSGAQLAECIK,,8496.42 -EHFLPTFNTEPLQDAK,,12017.76 -NGTLPPASLENGPTHAPVPIPFSLQHAAEPPVEK,,13856.039999999999 -LTDAEVDELLK,,11580.599999999999 -HIQQPISAMNTK,,5200.932 -IARFLEGQEYYEEALNISPDQDQK,,13836.960000000001 -PVALTSFLGYK,,13932.54 -HEEALEVDSLIK,,10023.300000000001 -EEPTIVTASNLK,,7912.679999999999 -DGVVIVNTARGAVIDEQAMTDALRSGK,,14235.179999999998 -VHSAFCDNLSTPVALK,,9897.84 -GINSSYAVWNDVTGK,,11567.16 -GFTNGAESRSDISQSTITK,,6302.04 -GITIQSAATYCSWDK,,10942.980000000001 -ILHQNGFSEQEIK,,6265.5 -GLEESHPNVK,,3654.414 -INHTEELLNILK,,12243.6 -EFHWEDVRGWSAEGGTNIGTAR,,12218.46 -MVDELENNGLIFVGK,,13799.76 -HMDLPEIAAK,,8027.280000000001 -EHIQQEESTYNDEAEIK,,5774.976 -PVNAPGGLPGLK,,8689.92 -LINDSVPDTIDTRVLNWPK,,14349.18 -IRVTPVDGLEGTVK,,8822.039999999999 -FEQVPDSLDDQIFVCEK,,13465.86 -LDDQWLVEVDDK,,12812.94 -KPFSFGTSQPNNTPSFSFGK,,11765.64 -NDFTNSTSNTQQYSIFK,,10844.7 -TNLDQFATGLVGTRSPYGK,,12294.24 -CEPLSEDDVARLCK,,8097.6 -DIEEEGDSIPLEQSTNGK,,9334.92 -GIDPMSLDVFAK,,15060.480000000001 -TLDVVERQLNAVLEEVK,,15367.140000000001 -VPMENYFPDYTGGSDINK,,12282.72 -KVNQGWGDDK,,3319.572 -YRQAITSAGSGCMAALDAEK,,7820.7 -YFNPNAQLIEDPLDK,,13066.259999999998 -NDYYGDTSATLTVDQIK,,10553.16 -STDVQRNEESSGHFFFTDK,,8075.94 -LTDDSSPIPYPEQPPIK,,10988.46 -YGGVYVGTLSKPEVK,,8028.48 -PSLVDVHLLESK,,11332.86 -AAPSPISHVAEIRSALEK,,10266.12 -ETSMPVIEYFETK,,14657.640000000001 -EADATPDDDRSSISSNSNK,,3583.1040000000003 -PNTSGTSDVEK,,2421.366 -AGRDYWWHEEAAK,,6782.28 -NLHVQFATLGDLK,,11742.960000000001 -SLIANIHRLGCTNTIVCNYDAREFPK,,12268.08 -ATNGVVIATEK,,4850.544 -DGSNSGYDLELIEHVK,,11583.24 -NYAVNVPLRDGIDDATYRSVFEPVIK,,14801.16 -HSNDSIFYPTK,,6243.839999999999 -STGNFMTLEQTVEK,,10773.66 -STSPNEIFSPSYSK,,8698.02 -IVFFTWSPDTAPVRSK,,14128.92 -VCHLMENIEK,,6227.22 -VAEYCGNK,,2693.412 -RSPENESLILNAVHK,,7407.0599999999995 -ALLSGCNDYLTK,,9203.22 -GVDAVCISDNYWLGTK,,13349.94 -NPFYGNDFK,,8070.84 -LVSNLHPSESLK,,5954.142 -PLDVVIPIGVLIK,,15408.720000000001 -VGLVCADTFRAGAFDQLK,,12964.02 -VNAITSQVVSK,,5746.998 -TGTLTTSETAHNMK,,3833.2740000000003 -QVANEAASDVLFGNESVK,,10826.880000000001 -LVTCEGSEEK,,3227.7599999999998 -PESALPLGK,,6247.5 -AEQERSTPNSGGMNK,,2515.866 -LFPWQNVGEFHASGK,,12689.400000000001 -KFEATQEENEQEMEK,,4644.701999999999 -LGPEITVAALK,,11063.46 -YVDEQSKNELK,,3631.104 -NDEDDTTENINESK,,3712.05 -DTTFLLFTSDDK,,14682.72 -HFICFDECK,,7745.34 -SFTSIQIYNHLMEK,,11990.279999999999 -SRTLLSVPGYDEK,,8836.86 -VCDIEYEQLCNVDSK,,9408.779999999999 -VELDAERIETAEK,,7285.08 -SDVAAPQGRIFASPLAK,,9708.119999999999 -KQEEVLDDTK,,3468.096 -DSEASSANSDEARAGLIEHVNFK,,9280.800000000001 -TQYSLSHDATLK,,5647.0380000000005 -AHQQPLDMCK,,4096.302 -GAHTIAVASTDEK,,3788.712 -GISTEQFELQNQEREK,,7471.2 -QEEAETLVQK,,4833.33 -LTFYEEVQPGTINEIYMK,,14838.119999999999 -VDGVDGEVELDDK,,7687.200000000001 -EVLPDLQNLNLNTDK,,13355.52 -RQELEEASQQQQLQQNSK,,4618.451999999999 -CPICDSYVRPK,,5464.074 -DFDIEDEENASLFQHNEK,,11699.94 -YETSILEHSGIRLIEPELFNGYNPEK,,15297.359999999999 -WWINVCEEHNVEPPEECK,,11938.740000000002 -ATHFYVAPTALRLIK,,11459.34 -CQINESAPK,,3544.896 -RIVQPYIEEMCNNGRLK,,8968.8 -ALVAQAIDERMDVDK,,9481.38 -YNHDVYWPALVETAREK,,11211.900000000001 -LAHLVDEEDWNITIK,,12777.18 -YAIDMTEQARQGK,,6110.099999999999 -ITAVIPQFPYSK,,12580.08 -DVLGEDGFWRVK,,12418.98 -HWGGGILGNK,,6744.54 -FEDTLNNSLLSDDDK,,10774.5 -SQGHPCPLYTVK,,5129.358 -EQAIVSVTPLLYYK,,14486.220000000001 -GIAFLEFDADK,,14273.16 -VGVEVEFGGK,,8098.799999999999 -NSEEDTDVITDK,,5107.5 -AIPELNARFLFIAPPSVEDLK,,15353.64 -TRTAASAGNGPTDDGTK,,2433.378 -LLLETDAPWCEIK,,14652.6 -VQDNLDQLNQELVGVK,,11948.88 -LPMEYITQGPDEVK,,10977.0 -LPVMEQYCIVGRK,,9720.0 -LIAKSNLAGK,,3876.864 -AMQFNTIGVSDGISMGTK,,12459.36 -DDEMIAVTSGNDGRLK,,7982.64 -FSSLTSTERDTPPSTTIEK,,7284.84 -NQAAMNPSNTVFDAK,,7852.320000000001 -VYAIEATCHAPK,,5519.4 -QQVVGEGTHFLVPWLQK,,14664.18 -MTSHLFGLK,,7972.679999999999 -EDIDQVFELFK,,15396.48 -DENISSENSEENTSDK,,3559.11 -PVAEHPLPEAEVDDK,,6208.32 -VTDDENINLIYMAK,,11856.240000000002 -ALIVTDPGIAAIGLSGRVQK,,13358.88 -VGLVTPTVMDIHTSEMGIK,,13154.7 -LDPTEIEEDVK,,10070.4 -GSMADVPK,,4051.464 -MSPYELVQHK,,7767.0599999999995 -NEEAAIDENSNVEAAERK,,5519.4 -GLPVLEEVEDEDAK,,12682.019999999999 -NPTNFTGGK,,3715.014 -YRPETAAEK,,2737.53 -LLNPTVASSMRK,,6409.8 -LNEFTDEWFK,,13521.18 -EQLEGSSGNNNIPMK,,6041.76 -ITLQLLDTSNQRFK,,11600.22 -EALQILNLTENTLTK,,15161.220000000001 -TFEQALEEERK,,6680.5199999999995 -LCNESSEVAALSGEISK,,10679.34 -LSMSPWGQLAK,,11739.119999999999 -VLGEVSSRTVDLVMSCGEK,,11832.06 -PGEGGELPAHK,,3267.678 -VCPQEDNRALLVMGEK,,8583.119999999999 -EYLPEMAASYSHPK,,8961.78 -QYAQEQGLLFREVSAK,,10204.619999999999 -PLPVEVMELDPADRSLDK,,13751.4 -ILAEETAAYEGNENEAEK,,7238.34 -YGAEYDLVDNK,,7780.98 -FVEGDNPEEFEK,,7608.6 -ASEFYYGFAGPK,,10716.72 -LDRVVCTNTVPFEEK,,8672.640000000001 -NCYRPLNEVLSTATLK,,11623.2 -ETSLFQGFK,,10662.18 -AYADSPENAIAVIK,,10301.94 -ASNISLGSVEQQQQQSITK,,8631.72 -DLSNAIGSYHVDLK,,11418.0 -VSSASGNAALSSNK,,3243.0899999999997 -PMTVVSQEWK,,8209.26 -IDYENHGVRK,,3282.846 -DAYAVRLGVEK,,7285.38 -TGFLNSAGFTENPTTIK,,12052.320000000002 -IRDIADNEVIELLK,,13550.04 -ANVGNVQQMDAK,,4617.618 -ELVETSEVRK,,4380.156 -LFDNFRSTPEIISLASK,,14645.7 -ANFSEYMNFLK,,14882.58 -EAMSNQTLLLPSDK,,9638.52 -PLDIRNEEQFASIK,,10047.72 -LPMIVVFNK,,13266.3 -TGTAISFVVPLK,,13192.320000000002 -IGLGYTLPELPNPITK,,15321.84 -HLTSYFTFK,,9528.539999999999 -RGYNEEQNYSEARK,,3262.08 -VALPIGIIASGIQYSMYDVK,,15448.98 -KPIDIDETIQK,,6544.74 -LWDVSNGQCVATWK,,11637.18 -SYPISEGPERANELVESYRK,,9889.02 -FSLPAPEAAQNNWK,,11377.679999999998 -QLLLLGNALPTVQSLSERK,,15307.14 -ALYSESAEELGALFHK,,14088.720000000001 -APIGTVVSPYSK,,7633.26 -YRPLTPSSEVYSPIEK,,8939.16 -CSIHLAGLEDSQYK,,8719.32 -ELSPNFSQEQTENK,,6572.22 -VTSSTSSSSSNGSVDVRK,,3086.484 -TAQQPQQFAPSPSNK,,5238.336 -DYSFVHLSAGDLLRAEQGRAGSQYGELIK,,14875.140000000001 -VNTLVRPNGTK,,3889.644 -LADTYISVFDK,,12138.84 -TAMPPTEVLLESIQSK,,15154.98 -EGVFDYVIK,,13072.5 -ANEESAADNLDHK,,3629.808 -SPAQLWAERK,,5945.706 -LVDFVHEHK,,5650.332 -YYNAVNPFEFMEDVATAGK,,15412.38 -LLDHLNPEYGISTQSAAGDFIK,,13473.779999999999 -AGTFLFTSESVGEGHPDK,,9933.0 -GFGFVCFSTPEEATK,,13506.960000000001 -PLFQNVPEQGEEPMK,,9844.02 -NPANFACDVCGK,,6801.36 -LVAPEMPLTEVRK,,9811.2 -SLSIAFENGDYAACEK,,10745.279999999999 -SAATFANQRIDPENK,,6133.62 -WCLSVNALDDVEEK,,13941.0 -PISNDETTLK,,4448.567999999999 -VNNCDTNEAAYK,,3335.688 -EQEVLDVWEK,,10785.06 -EGVSEACPVCEK,,4618.986 -LSLTHMVEAAK,,8235.72 -STTVMDILEK,,11577.6 -VYTEAAEDEIK,,6131.58 -VNVFLADMK,,10997.220000000001 -YEATAREWTK,,4796.994 -FALYTDFHHTVTPLSEK,,11567.16 -HTQDNVIMPLK,,6920.04 -NPQGYACPTHYLREM,,9093.36 -EPVVGDVIEK,,7632.360000000001 -NDANNEQWDSK,,3740.91 -RILNTADNPNTQLSSWK,,8909.460000000001 -SRVDQLNLNLTDDQIK,,10579.74 -SSRHTAADSSMNQMDAK,,3285.7019999999998 -VLELDPHFEK,,9169.44 -NALRSVELSELYLK,,11949.119999999999 -YDLEAWFPYQK,,15264.3 -LGGTTSDFSASSSVEEVK,,8289.78 -QASAAVSEKK,,1741.932 -SDGSAATSGFEFSK,,7647.96 -AQDENEGEFDHSK,,3240.732 -EQCIQIAEFYK,,11210.7 -SFYNNVFNFLMVDSPK,,15416.46 -CDICHYPIQFK,,9295.26 -LGVLIYELGELQDQFIDK,,15431.760000000002 -PSINGVNLELIKD,,12652.5 -VTAEHVLWYIPNK,,11303.039999999999 -DEEVFTLDPIVNK,,13809.36 -VSIGNTDQLTANK,,6716.28 -PMLYMEDRNLILTDGENENK,,12463.86 -EISDAQEIRLK,,6559.44 -VAFVESFGDNVVGVDYK,,14004.66 -RLAAPHHWLLDK,,7322.639999999999 -VFTREELTTLGNICVK,,11702.640000000001 -SGGNWAMTALGLGNSLGGSTK,,15129.42 -NLIYTLQTDELK,,12324.48 -FQSTDPSNSSHREK,,2624.376 -YYHEGIDPTK,,4778.892 -WKPEQENTVDFK,,7097.22 -DLESEYWPRLTK,,12226.68 -LNDCTNEAQQK,,2655.042 -LNTAISNLEVENK,,8696.699999999999 -SDDAANEHSCSGDCK,,1774.5300000000002 -PVRCVNCSK,,2262.594 -YDPWCDEMK,,8854.800000000001 -SRPSTAAAVFTTNK,,5384.88 -AALAASTTK,,2899.482 -RLSSTNIGNSIHEK,,4578.75 -FSTDDEEATSK,,3780.1440000000002 -NLATVEDVAK,,6683.1 -NTLEEYIYTLRGK,,13173.36 -LAYHTTTGQK,,3047.52 -MLVPSELSNASPDYIRSTLNAVPK,,15210.96 -ILTVDSNVNDWK,,10707.48 -ISPPVVAYR,,7817.099999999999 -YFHEDVSEDAY,,7874.219999999999 -TIVWNGPPGVFEFEK,,15320.64 -VVLDVDPAVYMINPK,,15123.9 -FIGVADYVSEETREPISYK,,12899.64 -LYDLLGVSPSANEQELK,,13129.859999999999 -PSTLTWSIK,,9691.74 -YNIQNWDSPEALDFK,,13883.28 -VGTIVGGQTSCK,,4303.206 -LWGDSFFNPK,,13809.66 -IASTWEGIQAAK,,8220.06 -LYTSYLDQCIK,,10222.92 -VVLLVPHCEGDGILK,,11603.28 -VGLSNYPLSASVACSK,,10124.820000000002 -LSIEGTPQVSQK,,6839.700000000001 -PIQDMISRGK,,6216.4800000000005 -QLPTPLVDDMNAK,,10574.16 -KLETLINQDFK,,9146.94 -KNDSDVPELATIPAAK,,8794.98 -DVCSVMNIWTK,,14038.5 -TATEVTPQEPK,,4080.858 -GFRELSDLTHK,,7229.700000000001 -AAASTPEPNLK,,4557.1320000000005 -GTNTHSYNVAQQQK,,3210.606 -ESLVCVNCK,,5635.428 -IEQYLQTYGASA,,9825.84 -ETSDDEEPQDK,,2177.796 -ESGSTPISISNAPTFNPK,,10510.08 -DSTGCVVGLSQPDAK,,7413.06 -LNNLRSTHDQNVK,,3210.258 -GIVVEAYSPFGSANAPLLK,,15129.42 -ITDGHVLMYIK,,9299.1 -ALNLNSESLENSSVEK,,8758.14 -TLGEGILEPTK,,9141.36 -AVASSGQELSVEER,,5657.526 -DTFDPNEVLAENK,,10804.44 -VEVNLAAIPLGK,,12689.16 -AQILENYNALFQQNIK,,13985.52 -TMTSFESGMDQESLPK,,9994.08 -DAEGERSSAINTSPISVVDK,,8900.880000000001 -SDDETINSVITTEENTVK,,11850.179999999998 -GILTTAREHHSSVK,,4163.016 -DLLENEQFLRIQK,,12527.640000000001 -WNAYQLLCK,,12076.92 -FFDHHQRGFFETFNEK,,10389.24 -TETGIDLENDRMAIQR,,8951.4 -YAGILDCFK,,11898.42 -ILGTSPDMIDSAENRYK,,9665.279999999999 -AETFHEMEK,,4078.0619999999994 -VSVATEQTK,,3148.314 -LDNCVMTSQGILK,,9620.52 -EIADNLTERQK,,4814.556 -FGELLYFDK,,13551.240000000002 -TNNVEEIMGNWNK,,11582.039999999999 -DFTYMDYLEK,,13787.34 -TVFHSDPNQLIDSAISK,,11553.66 -VDLPEYLLPPDLKPHPEEENENNDSK,,14271.54 -ESQPTIEEDLTRVYK,,10897.86 -NMTVPNPYDVDLNMEDIPACK,,14629.5 -SLSEVTSFVNENAPK,,11534.94 -HVTFGPYILGSTLGEGEFGK,,15142.56 -PVIDDATVK,,5453.886 -PFSTGDMK,,4693.794 -NGESLEGEEIK,,5388.6179999999995 -TVESGIVEDDK,,4989.24 -PFSTAVLAK,,7415.099999999999 -YSQHAVVDHDNK,,2777.856 -ELVQFAQDTLK,,11007.119999999999 -MHLIDLGIATEAEVK,,13432.56 -PGEAVIIPK,,6784.5 -VDEGSDVLNTWK,,9908.22 -LLQSFDHPNVSTIK,,8954.16 -NGLVLYCGDIITEDGK,,12682.320000000002 -FTYVTENTDPK,,6375.6 -LSSANNFQMDK,,5803.176 -SDVPEDPIYSK,,7094.4 -FGIAFISGTPSSSSEGLTIQK,,14631.960000000001 -HELSPSYFVK,,7777.74 -VPDVLHLNK,,8116.259999999999 -EEQQLLEQFLK,,14429.94 -EGIFQEELIYK,,12795.36 -LEDVHLPFPK,,10603.8 -TETGPESELLPEK,,8089.26 -RSTVAQLVQTLEQHDAMK,,13198.08 -EELVEIAYHK,,7987.92 -DTVTLELSCPSCDK,,9397.26 -ADGAYGVEK,,3463.134 -LSVVEDVSLLK,,12875.34 -LIAEWTRPIIGASDNYRDK,,11599.92 -EAENDEDSEVNAK,,2882.568 -SNDDSSLDATNHNSYK,,3980.532 -AENMIGEDRVNQFK,,7459.5599999999995 -ADILLLDEPTNHLDVSNVK,,13136.58 -IFEGIPPPYDK,,10519.619999999999 -LEINGNRLDEDSDALDLLQSK,,13613.88 -QNLYNAQGATIER,,6552.54 -ELRAQYGIK,,5089.5599999999995 -DAGTIAGLNVLR,,11996.4 -DEEVTTGVSDVAATK,,7054.98 -YIWSPINAANDSK,,11295.36 -ETTPEFWRAK,,7619.759999999999 -LQVANLQVASAK,,8533.26 -TQWEVSGYGDNVVGDNK,,9733.86 -TNNPETLVALR,,8878.14 -FITAPSGSVMDK,,8048.34 -MTPEEMRK,,3347.646 -ILATNPIMEAFGNAK,,15039.66 -LLVDVREPK,,7025.82 -VSQLFEEK,,6231.54 -CNDEQVFAITTK,,8806.38 -TTATAAQTSGTDNK,,2102.772 -EDGVPPTK,,3122.034 -GFTLAEVK,,8205.24 -YGMTLISDQEFEEYHILK,,14852.4 -MDNVISQLDTK,,9277.980000000001 -TIEFDESK,,5598.072 -ALFFPHLIGTAMDGTK,,15267.72 -IGGIGTVPVGRVETGVIK,,10665.480000000001 -ELHNAVSK,,2388.75 -VGYFSMHDINSFPTESGFATK,,13818.6 -YPYFPTK,,7988.459999999999 -FYTEHFGMK,,7293.660000000001 -ACIDEIQPFETTGK,,10327.5 -GFAFIDFK,,14108.22 -GNSALLEYTEK,,7685.28 -LQDLQNQIDEIENSMK,,15229.02 -ICSSEMINEQK,,5133.318 -VIDPIAPRHTAIVNPVK,,8547.960000000001 -NVQDLLILTR,,13593.18 -ELEQLVEFNRK,,9813.119999999999 -LSDSNTPVVEK,,4558.0199999999995 -TQDWRSHATQSLVFNTSDILAVK,,13986.78 -PLDIDYLK,,10750.92 -LIDCNSNPLK,,6865.68 -IAQDIFVVENK,,10116.66 -LEYSINDNEGVDEGK,,7709.400000000001 -IICSLNSLPTIGNGNLSLK,,14347.320000000002 -SRLLDLEQSSAK,,6964.0199999999995 -VLGVNFIEIAVK,,15379.38 -EYEEILAK,,6968.1 -DVTTTSANEGK,,2617.452 -GVVRNNYIGPGPPK,,5849.178 -LTSDDLNYFK,,10094.64 -LIIRFDDTNPSK,,9115.92 -YPSEFYTK,,6562.44 -LCSGVTIRNIK,,5959.782 -KWAAAGVCEK,,4282.259999999999 -SSVALATAQRGSAAIVPSQGK,,7719.360000000001 -FNDDFWEK,,10412.52 -NDAASAGHISK,,2474.3399999999997 -VDDLVLGK,,7175.76 -YSEGYPGER,,4356.834 -YDIWYDK,,9387.24 -YAGFSREINLK,,7927.14 -PLTYTGK,,3901.29 -PLTPADFRFTK,,10345.02 -QLEDGRTLSDYNIQK,,7492.799999999999 -LVFDEPFVK,,12554.88 -IQQPMSINEIK,,8494.08 -VFFLDSMK,,13090.92 -LGNFESPVLK,,9436.74 -STGLNYIDFK,,10501.5 -EYCDLITDLK,,11643.0 -AYRTPQNTITMFRPDK,,8103.18 -EDLIASIDSK,,9478.32 -NLIFQSCK,,7503.78 -SVNIEMGRTQQTK,,4820.226000000001 -GLADNGVFK,,7399.92 -TGEFDFEAAVK,,10761.66 -IIDVNAEHNNK,,3983.982 -QENVPTSYTSGLRERYMGVIEGMQITEAEK,,14298.84 -ESVNTFREMAK,,5878.2 -DWTGYLPERMK,,11433.48 -TEECEKASTK,,1510.296 -QSLDVSSDRRK,,3112.128 -TTGRQAQISNITAAK,,4678.956 -NFNGGVLMVSHDISVIDSVCK,,15199.26 -ALAIFVPVPSLAGFHK,,15351.240000000002 -SLLVFDVDK,,12676.02 -DLRGIIENSSK,,8783.82 -ITDVVNIGIGGSDLGPVMVTEALK,,15362.22 -LSEPFMELVDK,,13610.22 -RLMYDDLLK,,10120.140000000001 -SLNEQEEFEK,,5499.72 -AVDILSDILTK,,15323.099999999999 -LTEQNISQLK,,6453.0 -IEILYNTVALEAK,,13007.1 -TGTLTQNDMQLK,,6643.5 -SPSEWQDIIHQREQELQIK,,12846.3 -EDPDALTPEEVK,,7111.5599999999995 -VTLEYNANSK,,5512.38 -TPQEYESK,,2679.138 -SAVEVIEFVK,,11815.08 -TGLVSVDDDIYQK,,9679.32 -IIWETPLISK,,13209.539999999999 -CAGYDELYGYK,,8560.68 -DGSRAVDITNWNFIK,,13509.119999999999 -CILYDADESK,,6725.88 -FPLDVVYPDNNLK,,13360.02 -LLSDFFDGK,,13108.86 -LAEELGLVSRK,,7691.639999999999 -ELESYPTDK,,4731.066 -GLFISDDTTNPVIVARGYDK,,13076.52 -IEEEEYGEDAILK,,9348.720000000001 -ILVSGSWK,,7819.68 -DSTGIDNTLVLNEK,,9803.52 -EIPISDFINK,,12367.74 -YCEYLGK,,5192.142000000001 -MMNTSDSESTLYK,,6462.900000000001 -DATYTGIK,,4570.7519999999995 -ATETLWSLVK,,13180.380000000001 -CEVLSMK,,5609.603999999999 -SLGNVIDPLDVITGIK,,15403.800000000001 -PSNLLINSNCDLK,,8828.58 -MVINVPAEHVPR,,8595.480000000001 -INQALLGASSPK,,6644.52 -VSNWYHQK,,3879.84 -VDLMREESALEHQK,,7974.06 -TFLALQNFAESRK,,11520.06 -LETQLQENK,,4238.91 -IPAFTYEIGAIENSLLVLDPTYVK,,15467.519999999999 -TYFTLFEK,,12630.179999999998 -FSLSPSIEETRK,,7953.3 -FFADAVTK,,7585.8 -RSSTPQISNIESTGSGGMHK,,5589.102000000001 -ELQFIRVSSILK,,13609.68 -VTALFLPLRELK,,14200.44 -QFANTGANGQTNK,,3141.786 -SGIDEVQGAAAEK,,5525.748 -PYDVPGGK,,4366.884 -GLIMQNSLESSEIAK,,10495.98 -VLNADLDGETGK,,6227.22 -LIDVWYK,,10806.900000000001 -SCGGWADK,,3492.7619999999997 -TLAYGIPIVEK,,11622.119999999999 -DVTVPEPK,,5676.072 -VFSSALDVVK,,9947.880000000001 -GRETMYSVVQK,,5195.712 -DGEDIIFNYVPGPGTK,,14565.66 -SVPFPQAVK,,7473.96 -VSSTLNSK,,2515.5240000000003 -VEEMNNIIAASRRH,,6768.36 -VRALTEMK,,4297.872 -AMLYFTK,,8843.16 -QQLENLLVK,,9377.82 -LLLSAEVESLK,,12043.14 -VSWGPNMK,,6719.16 -LIDVAVEYGK,,9324.539999999999 -NDLYFRQEGVPMENTVRK,,8668.439999999999 -TYLQEHIK,,4859.5380000000005 -SYNQVNLDFVK,,10722.06 -VFHLQPVGNK,,6373.139999999999 -TIEEATPFIK,,9252.42 -PVSAVYIVK,,7573.86 -FDTSTWALPNK,,10976.76 -NTHDLHLRPGTY,,5527.194 -RFAHEIELVRK,,5728.38 -SFARIHETNLK,,4835.34 -YTREQVGCK,,2581.224 -DTPMLEVLK,,11919.720000000001 -DNFADEYVDEK,,8374.14 -ILSNLVYQYK,,10317.24 -LDQLEYQYHYLTK,,9716.220000000001 -GDLLFIDQPTGTGFSVEQNK,,14620.68 -GGNPELIRQSQK,,3834.39 -IVRDLSQLSDSINIMITK,,15167.34 -VPIMFTVDNFSK,,13942.019999999999 -SRLFILDEALTTSK,,13564.56 -LGEEVGYSIRFENK,,9635.04 -AIDALETIK,,8677.08 -FQNIQYAFNRK,,7769.400000000001 -SLVFEPSIK,,10284.78 -ESTLGREENMERLK,,5415.732 -ILQDDMACDVIK,,9896.880000000001 -LAGEFGLK,,7660.56 -WYPSEDVAAPK,,8346.18 -LGNLIAIYDDNK,,11854.14 -SFLLRDNTEINEK,,8095.199999999999 -GEYITYGFK,,9067.92 -EPGIITDK,,4918.764 -LADSIDVRDK,,5130.96 -CVCEVELPTQELVK,,11601.3 -DTFYITREK,,6339.3 -WTAEEEQELAK,,6852.18 -TLGADEEWICATQGHSIK,,10496.220000000001 -VEVGSYTK,,4286.9220000000005 -EFQEASEK,,3042.072 -FCYGIDDTLK,,10071.84 -SNFENLSEENK,,5604.354 -GSNLVLMGK,,7225.8 -LSIEDSPTSSADSK,,6132.78 -FGTDEVTFDK,,8494.380000000001 -SNGMCGSIIK,,5656.991999999999 -WSFDGNAPDVK,,9565.74 -NTTDLLSVVAHLK,,14785.08 -APSGLDQSRIPFSERK,,7228.5 -FPSNVDISK,,6877.62 -DFMVEQELLNTK,,13546.98 -MFSLQDVITTTK,,14373.42 -YYTITEVATR,,8633.28 -LPDFLMNK,,11522.94 -FEDTIYFRGK,,8029.02 -KLEQPSLEYLVEHAK,,11313.6 -EISDICIK,,7288.26 -VLIVDDSIVRGTTSK,,9708.119999999999 -DCANGRLPELISPVVK,,11625.539999999999 -QVLVVPVGVK,,9906.240000000002 -LIQELGQLQIK,,11643.84 -TFAEALRIGSEVYHNLK,,14679.66 -YSEGYPGERYYGGNEIIDK,,8890.5 -IVIGFEQK,,8622.06 -ITFNEGSDWNFLK,,14715.539999999999 -LRFNQIQDLAENFK,,13662.960000000001 -AVADWPVLGK,,11055.72 -AERLTEHCQGAQIWLK,,7666.74 -CINTSYSEGELNK,,6169.0199999999995 -EDESLPAAIK,,6988.38 -NVKEEETVAK,,2731.8179999999998 -EEVNDDYSK,,3214.194 -EVNITTLITK,,11650.02 -AEEILERGLK,,6497.28 -ISESDLAVLK,,9777.72 -FIAVSLESDSLTK,,11736.66 -DLNIPTLNRAIVPGVK,,13442.76 -REPFFHGTSNTDQLVK,,7423.0199999999995 -ESEISSDSIYK,,6394.62 -LLEVAFLDTTK,,13819.98 -TTDDITTK,,2813.004 -AYFTAPSSERRVLLSAPLSK,,10654.98 -FNCLFCNHEK,,6623.46 -EDSIEGIYDTLK,,12776.64 -QLLFNFPK,,13237.14 -GIVGLPTK,,7310.04 -IGHLRDGLK,,4297.872 -LMFVTSPGNPTGAK,,9870.42 -IETPVTPTETK,,5920.968 -ILQTPIIIEK,,10721.279999999999 -LVNLDGTSANEENTMK,,7462.44 -APADAEK,,1422.348 -AITRMEFPGLTPVQQK,,11212.38 -ETDSLQPITSK,,5803.518 -DSIFVNDNNLLNRNVELSK,,12632.52 -IVAALPTIK,,9608.099999999999 -DAFGDQAWGELEK,,12282.359999999999 -RMPMDFK,,6177.72 -SCSFLDIYNK,,11195.16 -VFFDPAVNGTK,,9607.56 -SPQQLSESTK,,3224.4660000000003 -NDLQSNICK,,4559.742 -WGLMPVMEK,,12747.18 -NLHLADCLRANK,,6673.92 -SYNEQEIK,,3706.2000000000003 -SLLQCGFPNTAGQK,,9433.2 -ADVQVALPEGLDAK,,10866.06 -CLTPLQEYDRLVK,,11733.539999999999 -RYILQNELPRDQIK,,7975.259999999999 -YTNGATPLYK,,5339.4 -GIDCVEK,,3610.968 -IIVGVDRLDYIK,,11135.04 -FESELNEK,,4614.773999999999 -DALNNHLGISNK,,6230.16 -VVEEINK,,3538.9019999999996 -QQAHFWK,,4710.299999999999 -HITQGLK,,3024.096 -VLLVPLSNHK,,8090.639999999999 -AEFFTLK,,10315.26 -ELDVCQTAK,,4634.778 -FTDTLSGK,,4868.592 -VSLDRVQDFLNENDTK,,11945.460000000001 -IDDRFHLAILEGHNINK,,11009.820000000002 -STDVNDERLGVK,,4629.87 -VVPSSEIPEEPAILIK,,12881.880000000001 -WLLIASK,,11263.26 -EGTAGERENENESNVK,,2460.522 -ERTEQIEHILK,,6222.900000000001 -KAEYFAK,,3448.9019999999996 -LQNLQPIK,,5974.416 -RTPMDLRHK,,3326.436 -NTALYRFK,,5657.262 -LCEGNAGMAK,,3562.4339999999997 -NNLILAILK,,15312.06 -DGIIYLERGPK,,8732.1 -TPIPSLGNK,,6591.0599999999995 -GGNIPMIPGWVMEFPTGK,,15380.580000000002 -GLQEFLLK,,12190.08 -LPPQYQFLEK,,10270.32 -NISNRVGLTLDNIDDINK,,11588.7 -RHITYANSDISNK,,3770.202 -TYSNNSNLK,,2877.2459999999996 -AASLSPK,,2825.544 -INSISLNELK,,9502.980000000001 -DDGSQSPIRK,,2806.44 -ALELSEVK,,6772.38 -DGIFNYK,,8744.88 -TIILCSPGFYAK,,11603.58 -RNSSGEEVDDGLK,,3682.854 -VNIVQDEPVNVEK,,7999.68 -VEVISSTLPNTGIGK,,10066.68 -PILESLQYTAR,,10351.44 -FIQTNEFRDIEEQMNK,,11869.32 -VIEEWSTGDK,,6517.56 -QLIAGKSSDSK,,2923.3740000000003 -ILIANTTLDTDK,,9103.8 -AQETTPARTNIEK,,3455.652 -ISQAYSSGEVK,,4110.87 -VTQQQLIGHK,,4104.18 -SFVVLDTGK,,8841.6 -NQFDFVEGEISK,,11560.5 -LPSVPECFTIEK,,11740.26 -KVPLIAIPTELAPK,,13183.26 -YGYGLSK,,5048.196 -VAIIPHASFTTIK,,10230.36 -VRSAEYYAK,,3343.602 -LVSSSGIK,,3770.736 -VVEVGGFHNLK,,6877.32 -RTVDPVKK,,2306.1000000000004 -FVVQVEDK,,6813.3 -HTNDEEEIEK,,2814.2039999999997 -IDGALILAYAELNK,,15347.52 -WDIRVDEALQQFSK,,14652.84 -SVEQFSSAPK,,4876.9800000000005 -NFDNVPAEEEEIK,,8254.44 -EYQGFQK,,4004.9040000000005 -TALSECIAIFNNK,,12202.86 -AMDNGLSLPISRNGSSNNIK,,9194.88 -EPSPANARK,,2003.3400000000001 -YLTQFEK,,6436.9800000000005 -EQFAAMNNGK,,4682.639999999999 -EDEEVLAK,,4105.65 -NLVSGNIK,,5124.294 -YGLNICRQCFREK,,7090.02 -NGVDSLDPFDQIK,,13157.58 -DPYDTLGLK,,9411.78 -FNGTLEAFTK,,9602.52 -NDAAVIAK,,3421.2659999999996 -LLNLPMYK,,11527.92 -SANELVETLSK,,8901.36 -DLPDLYEGK,,9474.48 -TNIVVERK,,3513.0899999999997 -GGNVLPIHYDPK,,7987.08 -EEEQQYGQNGK,,2433.378 -MQGRVGGSISDSK,,3637.3740000000003 -NLSDSQRDVLVK,,5780.25 -EIGFYSRTK,,5437.482 -AVVISDER,,4386.378000000001 -QHSFPNPK,,3421.2659999999996 -LADAIYK,,5421.474 -QVCACTGK,,2093.118 -TSTPTVGFNVETVTYK,,11087.220000000001 -RIPIIIPENYK,,10380.480000000001 -LWGTEQRDPEAALNK,,8016.960000000001 -YDQCAVSCSFK,,6319.98 -PFLPENVIK,,10991.1 -VAAEQPSTLNAESIK,,6807.900000000001 -EQWQSGLK,,5455.356 -KEPLNEESKP,,3278.178 -MQLLRTHPNNIK,,5563.0199999999995 -FSTEFAK,,6015.240000000001 -ILMVGLDGAGK,,10314.119999999999 -VLAGISVPPRENLTFQK,,10946.82 -EEEMAPYYK,,6215.34 -DMSPILGELK,,12394.68 -EQTCIMK,,3756.384 -SEGAEEESK,,1459.6200000000001 -WYEFLYPNHTTQTK,,11308.92 -NYQVCAGMYSK,,6526.9800000000005 -APLITPK,,4987.29 -VYYNLGEYESAVK,,10649.1 -YFAQFGDLK,,10603.14 -SILSLYSK,,9724.56 -AISQCHFSNK,,3544.896 -YNGQGYQK,,2552.7000000000003 -ADESDPVESK,,2995.4519999999998 -LIQSWPVQVK,,10469.16 -IDLFEEK,,9115.199999999999 -ILSDVLAK,,8071.200000000001 -LQAVIQDTENGHDEFTLK,,10645.08 -GSSTSYAIKK,,3098.658 -DFIINTMK,,10441.560000000001 -AEFLSHLPK,,7823.9400000000005 -IFASNEVIAK,,7328.5199999999995 -ENIDSEALK,,5051.376 -QGSSQKVAASAPK,,2573.952 -ETESQENIK,,2561.574 -NLSILTSK,,7503.78 -DRYLNLELK,,9282.72 -AIDEQFGSLDELIK,,14835.0 -LYPEFVQLDK,,11807.880000000001 -NLEALRSK,,3998.988 -SPIPITNK,,5211.756 -TLTSSSVRNCQGDLQEFK,,7443.839999999999 -YSAQLRNFEK,,5780.25 -CATITPDEARVK,,4898.316 -NSIIPLVATSK,,10559.76 -WEDVAGLEGAK,,8791.02 -GLWSETLNRK,,7556.1 -NPPSSFCLEIGLK,,13040.58 -SLGFLQQSNK,,8120.04 -EDLENMRTHLLK,,8023.799999999999 -LLNASNFPAITVHGHMK,,9969.18 -NLVEINPLK,,10378.14 -AQAIPVYK,,5724.3 -YQEVRDFEYPAFK,,10205.82 -QLQELQRLQK,,5964.396 -QGPVTVDVPLTEPYFTRFK,,14427.48 -DGVVTINRNDYTFQK,,8888.58 -EEETVAK,,1978.794 -ILTIRESNTSPAFIFHK,,11209.5 -PGDRGALARASGNYVIIIGHNPDENK,,9453.720000000001 -TVEVYPDEATK,,5946.24 -NHDVLETTTHK,,3382.464 -KAPDGRIVELVK,,6670.2 -EQLSFINPK,,8856.42 -LLNMTTDEIK,,8974.859999999999 -FELNFITK,,12723.66 -YLAAEAK,,3378.786 -IGPSVER,,4118.934 -FVVLNPTQSGLVK,,11708.22 -QNNPSNDSSSSSSSTGIK,,2930.964 -MYDYEEK,,4595.628 -DGTEVLQSIEDRK,,9325.800000000001 -YLPSVVK,,6574.8 -LCFYNEAGK,,7153.5599999999995 -LYTWNVK,,8198.94 -IAIVSADK,,5217.792 -NLSYLPITGSK,,10121.699999999999 -VQEINEEDILK,,9060.179999999998 -SSAAETEAEK,,1965.912 -TAWDFLEENQSSIK,,13556.94 -EGHPIAEGLVK,,5878.47 -AVLELSESHLNGRNMLIK,,10577.52 -LYQIINPDLMHVK,,12660.66 -LVFPIDFPSQRK,,13136.34 -YLAPAYK,,5275.4580000000005 -LNSLTNLLSK,,11042.34 -LDSLFEGLHDK,,10075.26 -EIVIPITK,,9403.380000000001 diff --git a/streamlit/requirements.txt b/streamlit/requirements.txt deleted file mode 100644 index 99f5d5f..0000000 --- a/streamlit/requirements.txt +++ /dev/null @@ -1,5 +0,0 @@ -plotly -pandas -statsmodels -streamlit>=0.88 -deeplc diff --git a/streamlit/streamlit_utils.py b/streamlit/streamlit_utils.py deleted file mode 100644 index c3a7df7..0000000 --- a/streamlit/streamlit_utils.py +++ /dev/null @@ -1,83 +0,0 @@ -"""Streamlit utils.""" - -import logging - -import streamlit as st - - -class StreamlitLogger: - """Pickup logger and write to Streamlit front end.""" - - def __init__(self, placeholder, logger_name=None, accumulate=True, persist=True): - """ - Pickup logger and write to Streamlit front end. - - Parameters - ---------- - placeholder: streamlit.empty - Streamlit placeholder object on which to write logs. - logger_name: str, optional - Module name of logger to pick up. Leave to None to pick up root logger. - accumulate: boolean, optional - Whether to accumulate log messages or to overwrite with each new - message, keeping only the last line. (default: True) - persist: boolean, optional - Wheter to keep the log when finished, or empty the placeholder element. - - """ - self.placeholder = placeholder - self.persist = persist - - self.logging_stream = _StreamlitLoggingStream(placeholder, accumulate) - self.handler = logging.StreamHandler(self.logging_stream) - self.logger = logging.getLogger(logger_name) - - def __enter__(self): - self.logger.addHandler(self.handler) - - def __exit__(self, exc_type, exc_val, exc_tb): - self.logger.removeHandler(self.handler) - if not self.persist: - self.placeholder.empty() - - -class _StreamlitLoggingStream: - """Logging stream that writes logs to Streamlit front end.""" - - def __init__(self, placeholder, accumulate=True): - """ - Logging stream that writes logs to Streamlit front end. - - Parameters - ---------- - placeholder: streamlit.empty - Streamlit placeholder object on which to write logs - accumulate: boolean, optional - Whether to accumulate log messages or to overwrite with each new - message, keeping only the last line (default: True) - """ - self.placeholder = placeholder - self.accumulate = accumulate - self.message_list = [] - - def write(self, message): - if self.accumulate: - self.message_list.append(message) - else: - self.message_list = [message] - self.placeholder.markdown("```\n" + "".join(self.message_list) + "\n```") - - -def hide_streamlit_menu(): - hide_menu_style = """ - - """ - st.markdown(hide_menu_style, unsafe_allow_html=True) - - -@st.cache -def save_dataframe(df): - """Save dataframe to file object, with streamlit cache.""" - return df.to_csv().encode("utf-8") diff --git a/uv.lock b/uv.lock new file mode 100644 index 0000000..2f769c4 --- /dev/null +++ b/uv.lock @@ -0,0 +1,4303 @@ +version = 1 +revision = 3 +requires-python = ">=3.11" +resolution-markers = [ + "python_full_version >= '3.14' and sys_platform == 'win32'", + "python_full_version >= '3.14' and sys_platform == 'emscripten'", + "python_full_version >= '3.14' and sys_platform != 'emscripten' and sys_platform != 'win32'", + "python_full_version == '3.13.*' and sys_platform == 'win32'", + "python_full_version == '3.12.*' and sys_platform == 'win32'", + "python_full_version < '3.12' and sys_platform == 'win32'", + "python_full_version == '3.13.*' and sys_platform == 'emscripten'", + "python_full_version == '3.12.*' and sys_platform == 'emscripten'", + "python_full_version < '3.12' and sys_platform == 'emscripten'", + "python_full_version == '3.13.*' and sys_platform != 'emscripten' and sys_platform != 'win32'", + "python_full_version == '3.12.*' and sys_platform != 'emscripten' and sys_platform != 'win32'", + "python_full_version < '3.12' and sys_platform != 'emscripten' and sys_platform != 'win32'", +] + +[[package]] +name = "aiofiles" +version = "25.1.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/41/c3/534eac40372d8ee36ef40df62ec129bee4fdb5ad9706e58a29be53b2c970/aiofiles-25.1.0.tar.gz", hash = "sha256:a8d728f0a29de45dc521f18f07297428d56992a742f0cd2701ba86e44d23d5b2", size = 46354, upload-time = "2025-10-09T20:51:04.358Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/bc/8a/340a1555ae33d7354dbca4faa54948d76d89a27ceef032c8c3bc661d003e/aiofiles-25.1.0-py3-none-any.whl", hash = "sha256:abe311e527c862958650f9438e859c1fa7568a141b22abcd015e120e86a85695", size = 14668, upload-time = "2025-10-09T20:51:03.174Z" }, +] + +[[package]] +name = "aiohappyeyeballs" +version = "2.6.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/33/c6/61a2d7b7572279226bb2e7f61d7a19ca7c90da0329c93fa0d560cbf288d8/aiohappyeyeballs-2.6.2.tar.gz", hash = "sha256:e202810ee718bd01fc6ef49e8ea53d023d5cb6b581076d7925aa499fa55dbe64", size = 22591, upload-time = "2026-05-20T15:12:24.631Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/5f/fc/a7bf5b6e4e617b45f90f2d9d2a68519c249c81dd4fc2658c7a2a61c4f4b7/aiohappyeyeballs-2.6.2-py3-none-any.whl", hash = "sha256:4708045e2d7a6c6bdf8aafa8ed39649eaf926a4543b54560659129e3365953c4", size = 15062, upload-time = "2026-05-20T15:12:23.328Z" }, +] + +[[package]] +name = "aiohttp" +version = "3.14.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "aiohappyeyeballs" }, + { name = "aiosignal" }, + { name = "attrs" }, + { name = "frozenlist" }, + { name = "multidict" }, + { name = "propcache" }, + { name = "typing-extensions", marker = "python_full_version < '3.13'" }, + { name = "yarl" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/82/78/8ea7308cac6934de8c74a14f3d5f65d1c89287426688be79538d0e5c013d/aiohttp-3.14.1.tar.gz", hash = "sha256:307f2cff90a764d329e77040603fa032db89c5c24fdad50c4c15334cba744035", size = 7955794, upload-time = "2026-06-07T21:09:35.529Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/26/dd/bf526e6f0a1120dd6f2df2e97bacfe4d358f13d17a0ff5847301a1375a51/aiohttp-3.14.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:aa00140699487bd435fde4342d85c94cb256b7cd3a5b9c3396c67f19922afda2", size = 765225, upload-time = "2026-06-07T21:06:07.957Z" }, + { url = "https://files.pythonhosted.org/packages/8f/e1/a2872aa55495a70f61310d411541c6ee23812d9a884e000c716e1bc3edbf/aiohttp-3.14.1-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:1c1af67559445498b502030c35c59db59966f47041ca9de5b4e707f86bd10b5f", size = 518743, upload-time = "2026-06-07T21:06:09.749Z" }, + { url = "https://files.pythonhosted.org/packages/5b/e7/c60c7b209e509cc787de3cea0550a518538cfc08003e1c1e14c1c63fff71/aiohttp-3.14.1-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:d44ec478e713ee7f29b439f7eb8dc2b9d4079e11ae114d2c2ac3d5daf30516c8", size = 514139, upload-time = "2026-06-07T21:06:11.26Z" }, + { url = "https://files.pythonhosted.org/packages/5b/8d/614ace2f579702c9840ab1e1447fd8509e35b0b904f7196418fa2f57b25d/aiohttp-3.14.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d3b1a184a9a8f548a6b73f1e26b96b052193e4b3175ed7342aaf1151a1f00a04", size = 1784088, upload-time = "2026-06-07T21:06:12.887Z" }, + { url = "https://files.pythonhosted.org/packages/49/e0/726e90f99542bf292f81a96a12cc4847deb86f3ccf62c6f4014a201f4d33/aiohttp-3.14.1-cp311-cp311-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:5f2504bc0322437c9a1ff6d3333ca56c7477b727c995f036b976ae17b98372c8", size = 1737835, upload-time = "2026-06-07T21:06:14.564Z" }, + { url = "https://files.pythonhosted.org/packages/0b/4b/d176d5c4db9d33dacf0543102ea59503bc1d528af4cfd0b719949ca49389/aiohttp-3.14.1-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:73f05ea02013e02512c3bf42714f1208c57168c779cc6fe23516e4543089d0a6", size = 1842801, upload-time = "2026-06-07T21:06:16.228Z" }, + { url = "https://files.pythonhosted.org/packages/dc/d6/5a99b563690ea0cbed912ae94a2ce33993a5709a651a3a4fe761e7dd973a/aiohttp-3.14.1-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:797457503c2d426bee06eef808d07b31ede30b65e054444e7de64cad0061b7af", size = 1929992, upload-time = "2026-06-07T21:06:17.947Z" }, + { url = "https://files.pythonhosted.org/packages/76/7f/a987b14a3859094b3cea3f4825219c3e5536242564af6e3f9c2f6c994eb2/aiohttp-3.14.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b821a1f7dedf7e37450654e620038ac3b2e81e8fa6ea269337e97101978ec730", size = 1786989, upload-time = "2026-06-07T21:06:19.677Z" }, + { url = "https://files.pythonhosted.org/packages/f1/1a/420e5c85a3e73349372ed22ce0b6af86bfa6ce16a4b20a64a2e94608c781/aiohttp-3.14.1-cp311-cp311-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:4cd96b5ba05d67ed0cf00b5b405c8cd99586d8e3481e8ee0a831057591af7621", size = 1640129, upload-time = "2026-06-07T21:06:22.558Z" }, + { url = "https://files.pythonhosted.org/packages/a7/80/18a592ed3be0a402cc03670bd72ee1f8563ddbe1d8d5542dbf868f274136/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:1d459b98a932296c6f0e94f87511a0b1b90a8a02c30a50e60a297619cd5a58ee", size = 1756576, upload-time = "2026-06-07T21:06:24.8Z" }, + { url = "https://files.pythonhosted.org/packages/ec/0b/8b3d5713373858ff71a617daf6e3b0e81ad63e79d09a3cf2f6b6b983939c/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:764457a7be60825fb770a644852ff717bcbb5042f189f2bd16df61a81b3f6573", size = 1754668, upload-time = "2026-06-07T21:06:26.528Z" }, + { url = "https://files.pythonhosted.org/packages/9f/49/fd564575cf225821d7ba5a117cb8bc27213d8a7e1811162afb43ae077039/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:f7a16ef45b081454ef844502d87a848876c490c4cb5c650c230f6ec79ed2c1e7", size = 1817019, upload-time = "2026-06-07T21:06:28.297Z" }, + { url = "https://files.pythonhosted.org/packages/ed/1b/e850c9ae6fc91356552ae668bb6c51e93fa29c8aef13398a10b56678557f/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:2fbc3ed048b3475b9f0cbcb9978e9d2d3511acd91ead203af26ed9f0056004cf", size = 1631638, upload-time = "2026-06-07T21:06:30.242Z" }, + { url = "https://files.pythonhosted.org/packages/eb/94/3c337ba72451a89806ace6f75bddc92bafc5b8d53d90115a512858024b63/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:bedb0cd073cc2dc035e30aeb99444389d3cd2113afe4ef9fcd23d439f5bade85", size = 1835660, upload-time = "2026-06-07T21:06:31.943Z" }, + { url = "https://files.pythonhosted.org/packages/2b/9c/9c18cf367a0498212d9ba7daf990b504a5e8ae064cda4b504e2647c89c03/aiohttp-3.14.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:b6feea921016eb3d4e04d65fc4e9ca402d1a3801f562aef94989f54694917af3", size = 1775698, upload-time = "2026-06-07T21:06:33.72Z" }, + { url = "https://files.pythonhosted.org/packages/b5/63/a251a9d2a6cb45065b2ddc0bde2b3dd10108740a9a42f632c66405a761a2/aiohttp-3.14.1-cp311-cp311-win32.whl", hash = "sha256:313701e488100074ce99850404ee36e741abf6330179fec908a1944ecf570126", size = 458386, upload-time = "2026-06-07T21:06:35.279Z" }, + { url = "https://files.pythonhosted.org/packages/17/ca/69274c51dcd6e8947d77b2806cf47a4a15f2c846e2cbeb1882547d3da283/aiohttp-3.14.1-cp311-cp311-win_amd64.whl", hash = "sha256:03ab4530fdcb3a543a122ba4b65ac9919da9fe9f78a03d328a6e38ff962f7aa5", size = 483406, upload-time = "2026-06-07T21:06:36.824Z" }, + { url = "https://files.pythonhosted.org/packages/2c/8a/c25904f77690c3688ec140f87591ef11a0cfe36bf3d5c0f1f38056fb62b3/aiohttp-3.14.1-cp311-cp311-win_arm64.whl", hash = "sha256:486f7d16ed54c39c2cbd7ca71fd8ba2b8bb7860df65bd7b6ed640bab96a38a8b", size = 452987, upload-time = "2026-06-07T21:06:38.371Z" }, + { url = "https://files.pythonhosted.org/packages/1d/21/151624b51cd92553d95424daf4bf19f19ce9be9002d19253e7e7ce67197b/aiohttp-3.14.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:d35143e27778b4bb0fb189562d7f275bff79c62ab8e98459717c0ea617ff2480", size = 757402, upload-time = "2026-06-07T21:06:40.311Z" }, + { url = "https://files.pythonhosted.org/packages/c2/82/280619e0bd7bf2454987e19282616e84762255dd9c8468f62382e8c191f1/aiohttp-3.14.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:bcfb80a2cc36fba2534e5e5b5264dc7ae6fcd9bf15256da3e53d2f499e6fa29d", size = 512310, upload-time = "2026-06-07T21:06:42.207Z" }, + { url = "https://files.pythonhosted.org/packages/55/b2/2aac325583aaa1353045f96dffa586d8a34e8322e14a7ba49cffeb103ab4/aiohttp-3.14.1-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:27fd7c91e51729b4f7e1577865fa6d34c9adccbc39aabe9000285b48af9f0ec2", size = 512448, upload-time = "2026-06-07T21:06:43.813Z" }, + { url = "https://files.pythonhosted.org/packages/8a/72/a60607cb849faa8af8a356c9329ea2eb6f395d49e82cc82ccba1fd8deb8f/aiohttp-3.14.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:64c567bf9eaf664280116a8688f63016e6b32db2505908e2bdaca1b6438142f2", size = 1766854, upload-time = "2026-06-07T21:06:45.391Z" }, + { url = "https://files.pythonhosted.org/packages/b5/d3/d9fe1c9ec7557ab4d0d82bebaa728c6418f0b93295ec2f4ab015f7710cc7/aiohttp-3.14.1-cp312-cp312-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:f5e6ff2bdbb8f4cd3fbe41f99e25bbcd58e3bf9f13d3dd31a11e7917251cc77a", size = 1740884, upload-time = "2026-06-07T21:06:47.413Z" }, + { url = "https://files.pythonhosted.org/packages/c1/dc/f2cecfaf9337ba3e63f181500814ff502aa3d00d9c7ec93a9d23d10a27b2/aiohttp-3.14.1-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:2f73e01dc37122325caf079982621262f96d74823c179038a82fddfc50359264", size = 1810034, upload-time = "2026-06-07T21:06:50.165Z" }, + { url = "https://files.pythonhosted.org/packages/66/d7/2ff65c5e65c0d7476daf7e15c032e0805e36811185b9623e3238ad6c763e/aiohttp-3.14.1-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:bb2c0c80d431c0d03f2c7dbf125150fedd4f0de17366a7ca33f7ccb822391842", size = 1904054, upload-time = "2026-06-07T21:06:52.035Z" }, + { url = "https://files.pythonhosted.org/packages/20/9c/d445818389df371f56d141d881153ba23183c4735a03f7356ffb43f7757d/aiohttp-3.14.1-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:3e6fc1a85fa7194a1a7d19f44e8609180f4a8eb5fa4c7ed8b4355f080fad235c", size = 1790278, upload-time = "2026-06-07T21:06:54.049Z" }, + { url = "https://files.pythonhosted.org/packages/4d/aa/bf04cb4d865fc6101c2229a294ad744973b72e513fdc5a6b791e6983d72a/aiohttp-3.14.1-cp312-cp312-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:686b6c0d3911ec387b444ddf5dc62fb7f7c0a7d5186a7861626496a5ab4aff95", size = 1591795, upload-time = "2026-06-07T21:06:55.911Z" }, + { url = "https://files.pythonhosted.org/packages/dc/b4/4dac0038960427ba832f6609dfb4ea5437d7fd80c72001b9e48f834f428b/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:c6fa4dc7ad6f8109c70bb1499e589f76b0b792baf39f9b017eb92c8a81d0a199", size = 1728397, upload-time = "2026-06-07T21:06:57.777Z" }, + { url = "https://files.pythonhosted.org/packages/2b/f9/7cd4e8ad7aa3b75f17d56bb5498dd604a93d4e6eece822ba0568c413fff0/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:87a5eea1b2a5e21e1ebdbb33ad4165359189327e63fc4e4894693e7f821ac817", size = 1766504, upload-time = "2026-06-07T21:07:00.009Z" }, + { url = "https://files.pythonhosted.org/packages/f9/df/fc01d9fcad0f73fed3f3d361f1f94f975947b50dff82919f6dc2bf4316cc/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:1c1421eb01d4fd608d88cc8290211d177a58532b55ad94076fb349c5bf467f0a", size = 1777806, upload-time = "2026-06-07T21:07:02.064Z" }, + { url = "https://files.pythonhosted.org/packages/41/09/47e2d090bddcc8fb4ccb4c314aadc32d7c5d9bb55f50f6ad1c92fc15d501/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:34b257ec41345c1e8f2df68fa908a7952f5de932723871eb633ecbbff396c9a4", size = 1580707, upload-time = "2026-06-07T21:07:03.942Z" }, + { url = "https://files.pythonhosted.org/packages/3d/36/f1a4ce904ae0b6930cfe9afc96d0896f7ec1a620c400405d63783bb95a9c/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:de538791a80e5d862addbc183f70f0158ac9b9bb872bb147f1fd2a683691e087", size = 1798121, upload-time = "2026-06-07T21:07:05.987Z" }, + { url = "https://files.pythonhosted.org/packages/70/0a/e0075ce9ca0279ee1d4f0c0b85f54fea02ebc83c3007651a72bece658fec/aiohttp-3.14.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:6f71173be42d3241d428f760122febb748de0623f44308a6f120d0dd9ec572e3", size = 1767580, upload-time = "2026-06-07T21:07:07.873Z" }, + { url = "https://files.pythonhosted.org/packages/3e/61/a0c0a8f327a9c52095cdd8e312391b00d3ed64ab6c72bb5c33d8ec251cf7/aiohttp-3.14.1-cp312-cp312-win32.whl", hash = "sha256:ec8dc383ee57ea3e883477dcca3f11b65d58199f1080acaf4cd6ad9a99698be4", size = 452771, upload-time = "2026-06-07T21:07:09.669Z" }, + { url = "https://files.pythonhosted.org/packages/df/d9/ea367c75f16ac9c6cdc8febb25e8318fa21a2b1bc8d6514d4b2d890bface/aiohttp-3.14.1-cp312-cp312-win_amd64.whl", hash = "sha256:2aa92c87868cd13674989f9ee83e5f9f7ea4237589b728048e1f0c8f6caa3271", size = 479873, upload-time = "2026-06-07T21:07:11.538Z" }, + { url = "https://files.pythonhosted.org/packages/03/64/8d96784a7851156db8a4c6c3f6f91042fdf39fb15a4cc38c8b3c14833c45/aiohttp-3.14.1-cp312-cp312-win_arm64.whl", hash = "sha256:2c840c90759922cb5e6dda94596e079a30fb5a5ba548e7e0dc00574703940847", size = 448073, upload-time = "2026-06-07T21:07:13.637Z" }, + { url = "https://files.pythonhosted.org/packages/bc/97/bd137012dd97e1649162b099135a80e1fd59aaa807b2430fc448d1029aff/aiohttp-3.14.1-cp313-cp313-android_21_arm64_v8a.whl", hash = "sha256:b3a03285a7f9c7b016324574a6d92a1c895da6b978cb8f1deee3ac72bc6da178", size = 506882, upload-time = "2026-06-07T21:07:15.501Z" }, + { url = "https://files.pythonhosted.org/packages/ef/79/e5cc690e9d922a66887ceeaca53a8ffd5a7b0be3816142b7abc433742d89/aiohttp-3.14.1-cp313-cp313-android_21_x86_64.whl", hash = "sha256:2a73f487ab8ef5abbb24b7aa9b73e98eaba9e9e031804ff2416f02eca315ccaf", size = 515270, upload-time = "2026-06-07T21:07:17.53Z" }, + { url = "https://files.pythonhosted.org/packages/fe/22/a73ccbf9dbd6e26dda0b24d5fd5db7da92ee3383a79f47677ffb834c5c5b/aiohttp-3.14.1-cp313-cp313-ios_13_0_arm64_iphoneos.whl", hash = "sha256:915fbb7b41b115192259f8c9ae58f3ddc444d2b5579917270211858e606a4afd", size = 485841, upload-time = "2026-06-07T21:07:19.555Z" }, + { url = "https://files.pythonhosted.org/packages/3b/b9/57ed8eaf596321c2ad747bd480fb1700dbd7177c60dfc9e4c187f629662e/aiohttp-3.14.1-cp313-cp313-ios_13_0_arm64_iphonesimulator.whl", hash = "sha256:7fb4bdf95b0561a79f259f9d28fbc109728c5ee7f27aff6391f0ca703a329abe", size = 492088, upload-time = "2026-06-07T21:07:21.581Z" }, + { url = "https://files.pythonhosted.org/packages/78/c0/5ebe5270a7c140d7c6f79dcb018640225f14d406c149e4eec04a7d82fe71/aiohttp-3.14.1-cp313-cp313-ios_13_0_x86_64_iphonesimulator.whl", hash = "sha256:1b9748363260121d2927704f5d4fc498150669ca3ae93625986ee89c8f80dcd4", size = 501564, upload-time = "2026-06-07T21:07:23.388Z" }, + { url = "https://files.pythonhosted.org/packages/75/7f/8cdaa24fc7983865e0915153b96a9ac5bcdd3548d64c5a27d17cecccad2d/aiohttp-3.14.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:86a6dab78b0e43e2897a3bbe15745aa60dc5423ca437b7b0b164c069bf91b876", size = 751998, upload-time = "2026-06-07T21:07:25.046Z" }, + { url = "https://files.pythonhosted.org/packages/b2/f4/c4227aacfacc5cb0cc2d119b65301d177912a6842cd64e120c47af76064f/aiohttp-3.14.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:4dfd6e47d3c44c2279907607f73a4240b88c69eb8b90da7e2441a8045dfd21da", size = 510918, upload-time = "2026-06-07T21:07:27.28Z" }, + { url = "https://files.pythonhosted.org/packages/ab/01/a2d5f96cd4e74424864d30bc0a7e44d0a12dacdcfa91b5b2d1bd3dca6bf3/aiohttp-3.14.1-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:317acd9f8602858dc7d59679812c376c7f0b97bcbbf16e0d6237f54141d8a8a6", size = 508657, upload-time = "2026-06-07T21:07:29.252Z" }, + { url = "https://files.pythonhosted.org/packages/e8/ed/3c0fb5c500fdd8e7ebc10d1889c04384fffa1a9163eac1356088ca9da1b1/aiohttp-3.14.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:bd869c427324e5cb15195793de951295710db28be7d818247f3097b4ab5d4b96", size = 1757907, upload-time = "2026-06-07T21:07:31.03Z" }, + { url = "https://files.pythonhosted.org/packages/0b/ab/d4c924d9bd5be3050c226612413ce68cb54c70d2c31b661bfc8d9a5b6a70/aiohttp-3.14.1-cp313-cp313-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:93b032b5ec3255473c143627d21a69ac74ae12f7f33974cb587c564d11b1066f", size = 1737565, upload-time = "2026-06-07T21:07:33.031Z" }, + { url = "https://files.pythonhosted.org/packages/19/2a/37326821ff779084020cdc33224d20b19f42f4183a500ff92022a739eda7/aiohttp-3.14.1-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f234b4deb12f3ad59127e037bc57c40c21e45b45282df7d3a55a0f409f595296", size = 1799018, upload-time = "2026-06-07T21:07:35.003Z" }, + { url = "https://files.pythonhosted.org/packages/b3/4f/6e947ba73e4ce09070761c05ed3a8ceb7c21f5e46798671d8b2aac0e4626/aiohttp-3.14.1-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:9af6779bfb46abf124068327abcdf9ce95c9ef8287a3e8da76ccf2d0f16c28fa", size = 1894416, upload-time = "2026-06-07T21:07:36.956Z" }, + { url = "https://files.pythonhosted.org/packages/9d/6e/dbf1d0625dc711fb2851f4f3c3055c39ed58bae92082d8c627dbe6013736/aiohttp-3.14.1-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:faccab372e66bc76d5731525e7f1143c922271725b9d38c9f97edcc66266b451", size = 1783881, upload-time = "2026-06-07T21:07:39.063Z" }, + { url = "https://files.pythonhosted.org/packages/44/c2/5e25098a67268ed369483ae7d1a58bd0a13d03aab860d2a0e4a6eb25b046/aiohttp-3.14.1-cp313-cp313-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:f380468b09d2a81633ee863b0ec5648d364bd17bb8ecfb8c2f387f7ac1faf42c", size = 1587572, upload-time = "2026-06-07T21:07:41.058Z" }, + { url = "https://files.pythonhosted.org/packages/2a/bd/cf9cee17e140f942a3de73e658a543aa8fbf35a5fc67a9d2538d52d77f0b/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:97e704dcd26271f5bda3fa07c3ce0fb76d6d3f8659f4baa1a24442cc9ba177ca", size = 1722137, upload-time = "2026-06-07T21:07:43.014Z" }, + { url = "https://files.pythonhosted.org/packages/89/6d/5684f8c59045c96f81a18cefbc1fbbd79d25b88f1c622f2a5c5c08fcb632/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:269b76ac5394092b95bc4a098f4fc6c191c083c3bd12775d1e30e663132f6a09", size = 1755953, upload-time = "2026-06-07T21:07:45.933Z" }, + { url = "https://files.pythonhosted.org/packages/a8/40/35caf3170f8359760740a7d9aa0fff2e344bef98e1d1186f5a0f6dec17e6/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:5c0b3e614340c889d575451696374c9d17affd54cd607ca0babed8f8c37b9397", size = 1766479, upload-time = "2026-06-07T21:07:48.047Z" }, + { url = "https://files.pythonhosted.org/packages/6d/a1/b0c61e7a137f0d81de49a82023a6df73c3c16d6fefb0f8e4a93d21639002/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:5663ee9257cfa1add7253a7da3035a02f31b6600ec48261585e1800a81533080", size = 1580077, upload-time = "2026-06-07T21:07:50.069Z" }, + { url = "https://files.pythonhosted.org/packages/0b/41/194ea4623693009fcefebef7aef63c141754f153e9cd0d39d3b9e36c175c/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:603a2c834142172ffddc054067f5ec0ca65d57a0aa98a71bc81952573208e345", size = 1791688, upload-time = "2026-06-07T21:07:52.106Z" }, + { url = "https://files.pythonhosted.org/packages/ba/45/4de841f005cfe1fd63e2a2fe011262c515e2a62aa6994b15947e7d717ac9/aiohttp-3.14.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:cb21957bb8aca671c1765e32f58164cf0c50e6bf41c0bbbd16da20732ecaf588", size = 1761094, upload-time = "2026-06-07T21:07:54.113Z" }, + { url = "https://files.pythonhosted.org/packages/e4/ae/dbce10533d3896d544d5053939ed75b7dc31a1b0973d959b1b5ae21028d6/aiohttp-3.14.1-cp313-cp313-win32.whl", hash = "sha256:e509a55f681e6158c20f70f102f9cf61fb20fbc382272bc6d94b7343f2582780", size = 452662, upload-time = "2026-06-07T21:07:56.06Z" }, + { url = "https://files.pythonhosted.org/packages/7b/d9/0bf1a19362c32f06229da5e7ddfcec91f93474d6307f7a2d3135e9c674dc/aiohttp-3.14.1-cp313-cp313-win_amd64.whl", hash = "sha256:1ac8531b638959718e18c2207fbfe297819875da46a740b29dfa29beba64355a", size = 479748, upload-time = "2026-06-07T21:07:58.319Z" }, + { url = "https://files.pythonhosted.org/packages/22/0a/62e7232dc9484fbec112ceb32efb6a624cc7994ec6e2b019286f17c4e8f2/aiohttp-3.14.1-cp313-cp313-win_arm64.whl", hash = "sha256:250d14af67f6b6a1a4a811049b1afa69d61d617fca6bf33149b3ab1a6dbcf7b8", size = 447723, upload-time = "2026-06-07T21:08:00.154Z" }, + { url = "https://files.pythonhosted.org/packages/c4/a1/5fafa04e1ca91ddb47608699d60649c1c6db3cf41c99e78fc4056f9513db/aiohttp-3.14.1-cp314-cp314-android_24_arm64_v8a.whl", hash = "sha256:7c106c26852ca1c2047c6b80384f17100b4e439af276f21ef3d4e2f450ae7e15", size = 508531, upload-time = "2026-06-07T21:08:02.093Z" }, + { url = "https://files.pythonhosted.org/packages/fa/2e/bfa02f699d87ffc86d5959270b28f1cb410add3ccaced8ed2e0b8a5238fc/aiohttp-3.14.1-cp314-cp314-android_24_x86_64.whl", hash = "sha256:20205f7f5ade7aaec9f4b500549bbc071b046453aed72f9c06dcab87896a83e8", size = 514718, upload-time = "2026-06-07T21:08:04.476Z" }, + { url = "https://files.pythonhosted.org/packages/85/a5/9594ad6289eebbc97d167c44213d557807f90e59115caad24de21ad2c3b1/aiohttp-3.14.1-cp314-cp314-ios_13_0_arm64_iphoneos.whl", hash = "sha256:62a759436b29e677181a9e76bab8b8f689a29cb9c535f45f7c48c9c830d3f8c3", size = 487918, upload-time = "2026-06-07T21:08:06.377Z" }, + { url = "https://files.pythonhosted.org/packages/b4/61/16a32c36c3c49edec122a3dc811f2057df2f94d3b14aa107c8017d981618/aiohttp-3.14.1-cp314-cp314-ios_13_0_arm64_iphonesimulator.whl", hash = "sha256:2964cbf553df4d7a57348da44d961d871895fc1ee4e8c322b2a95612c7b17fba", size = 494014, upload-time = "2026-06-07T21:08:08.263Z" }, + { url = "https://files.pythonhosted.org/packages/9b/89/3ebcf96ed99c05bec9c434aaac6963fd3cbab4a786ae739908a144d9ce44/aiohttp-3.14.1-cp314-cp314-ios_13_0_x86_64_iphonesimulator.whl", hash = "sha256:237651caadc3a59badd39319c54642b5299e9cc98a3a194310e55d5bb9f5e397", size = 502398, upload-time = "2026-06-07T21:08:10.244Z" }, + { url = "https://files.pythonhosted.org/packages/fd/3d/b74870a0c2d40c355928cd5b96c7a11fa821b8a40fc41365e64479b151fb/aiohttp-3.14.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:896e12dfdbbab9d8f7e16d2b28c6769a60126fa92095d1ebf9473d02593a2448", size = 758018, upload-time = "2026-06-07T21:08:12.447Z" }, + { url = "https://files.pythonhosted.org/packages/d3/66/f42f5c984d99e49c6cff5f26f590750f2e2f7ef1fcfb99966ab5be1b632e/aiohttp-3.14.1-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:d03f281ed22579314ba00821ce20115a7c0ac430660b4cc05704a3f818b3e004", size = 512462, upload-time = "2026-06-07T21:08:14.624Z" }, + { url = "https://files.pythonhosted.org/packages/e9/a7/248e1aebe0c7810b0271e021a0f2a5eb6e78a051885b3c9df49f42a5802d/aiohttp-3.14.1-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:07eabb979d236335fed927e137a928c9adfb7df3b9ec7aa31726f133a62be983", size = 512824, upload-time = "2026-06-07T21:08:16.572Z" }, + { url = "https://files.pythonhosted.org/packages/26/97/2aa0e5ba0727dc3bd5aaebb7ccbc510f7dfb7fb961ec87497cd496635ab1/aiohttp-3.14.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4fe1f1087cbadb280b5e1bb054a4f00d1423c74d6626c5e48400d871d34ecefe", size = 1749898, upload-time = "2026-06-07T21:08:18.635Z" }, + { url = "https://files.pythonhosted.org/packages/00/8d/e97f6c96c891d457c8479d92a514ba194d0412f981d72c70341ee18488ed/aiohttp-3.14.1-cp314-cp314-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:367a9314fdc79dab0fac96e216cb41dd73c85bdca85306ce8999118ba7e0f333", size = 1710114, upload-time = "2026-06-07T21:08:20.892Z" }, + { url = "https://files.pythonhosted.org/packages/6f/e6/aa8d7e863048c8fceb5cd6ce74017311cec3ead07847387e12265fb4444e/aiohttp-3.14.1-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:a24f677ebe83749039e7bdf862ff0bbb16818ae4193d4ef96505e269375bcce0", size = 1802541, upload-time = "2026-06-07T21:08:23.044Z" }, + { url = "https://files.pythonhosted.org/packages/83/a8/72193137de57fda4ebfae4563182d082c8856e3b6e9871d0b46f028fb369/aiohttp-3.14.1-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:c83afe0ba876be7e943d2e0ba645809ad441575d2840c895c21ee5de93b9377a", size = 1875776, upload-time = "2026-06-07T21:08:25.288Z" }, + { url = "https://files.pythonhosted.org/packages/a0/18/938441025db6769a3464596b2410af3afde0b21eb2f204c6f766f68af4bd/aiohttp-3.14.1-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:634e385930fb6d2d479cf3aa66515955863b77a5e3c2b5894ca259a25b308602", size = 1760329, upload-time = "2026-06-07T21:08:27.363Z" }, + { url = "https://files.pythonhosted.org/packages/60/29/bf2496b4065e76e09fe48015aaffe5ce161d8f089b06ac6982070f653076/aiohttp-3.14.1-cp314-cp314-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:eeea07c4397bbc57719c4eed8f9c284874d4f175f9b6d57f7a1546b976d455ca", size = 1587293, upload-time = "2026-06-07T21:08:29.805Z" }, + { url = "https://files.pythonhosted.org/packages/49/a2/2136674d52123b1354bd05dd5753c318db47dc0c927cc70b27bab3755456/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:335c0cc3e3545ce98dcb9cfcb836f40c3411f43fa03dab757597d80c89af8a35", size = 1714756, upload-time = "2026-06-07T21:08:32.094Z" }, + { url = "https://files.pythonhosted.org/packages/a7/b9/e5fd2e6f915503081c0f9b1e8540947037929c70c191da2e4d54b31a21a1/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:ae6be797afdef264e8a84864a85b196ca06045586481b3df8a967322fd2fa844", size = 1721052, upload-time = "2026-06-07T21:08:34.167Z" }, + { url = "https://files.pythonhosted.org/packages/63/5a/2833e324a2263e104e31e2e91bc5bbee81bc499afd32203faee048a883f0/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:8560b4d712474335d08907db7973f71912d3a9a8f1dee992ec06b5d2fe359496", size = 1766888, upload-time = "2026-06-07T21:08:36.95Z" }, + { url = "https://files.pythonhosted.org/packages/57/fa/dea6511870913162f3b2e8c42a7614eb203a4540b8c2da43e0bfb0548f3c/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:2b7edd08e0a5deb1e8564a2fcd8f4561014a3f05252334671bbf55ddd47db0e5", size = 1581679, upload-time = "2026-06-07T21:08:39.292Z" }, + { url = "https://files.pythonhosted.org/packages/14/bd/3cf0d55e71784b33534e9710a67d382d900598b4787fbce6cc7317f8c42a/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:b6ff7fcee63287ae57b5df3e4f5957ce032122802509246dec1a5bcc55904c95", size = 1782021, upload-time = "2026-06-07T21:08:41.407Z" }, + { url = "https://files.pythonhosted.org/packages/c1/af/14bb5843eccbe234f4dfb78ab73e549d99727247e62ae5d62cbd22eaf5b0/aiohttp-3.14.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:6ffbb2f4ec1ceaff7e07d43922954da26b223d188bf30658e561b98e23089444", size = 1742574, upload-time = "2026-06-07T21:08:43.795Z" }, + { url = "https://files.pythonhosted.org/packages/f2/1e/fbeb7af9210a67ac0f9c9bec0f8f4568497924e33137a3d5b48e1cf85f3f/aiohttp-3.14.1-cp314-cp314-win32.whl", hash = "sha256:a9875b46d910cff3ea2f5962f9d266b465459fe634e22556ab9bd6fc1192eea0", size = 457773, upload-time = "2026-06-07T21:08:46.168Z" }, + { url = "https://files.pythonhosted.org/packages/f0/2b/13e8d741a9ec5db7d900c060554cf8352ab85e44e2a4469ebb9d377bda17/aiohttp-3.14.1-cp314-cp314-win_amd64.whl", hash = "sha256:af8b4b81a960eeaf1234971ac3cd0ba5901f3cd42eae42a46b4d089a8b492719", size = 485001, upload-time = "2026-06-07T21:08:48.401Z" }, + { url = "https://files.pythonhosted.org/packages/df/30/491acfa2c4d6c3ff59c49a14fc1b50be3241e25bbb0c84c09e2da4d11395/aiohttp-3.14.1-cp314-cp314-win_arm64.whl", hash = "sha256:cf4491381b1b57425c315a56a439251b1bdac07b2275f19a8c44bc57744532ec", size = 453809, upload-time = "2026-06-07T21:08:50.7Z" }, + { url = "https://files.pythonhosted.org/packages/34/e3/19dbe1a1f4cc6230eb9e314de7fe68053b0992f9302b27d12141a0b5db53/aiohttp-3.14.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:819c054312f1af92947e6a55883d1b66feefab11531a7fc45e0fb9b63880b5c2", size = 793320, upload-time = "2026-06-07T21:08:52.775Z" }, + { url = "https://files.pythonhosted.org/packages/7f/20/1b7182219ba1b108430d6e4dc53d25ae02dcfcf5a045b33af4e8c5167527/aiohttp-3.14.1-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:10ee9c1753a8f706345b22496c79fbddb5be0599e0823f3738b1534058e25340", size = 529077, upload-time = "2026-06-07T21:08:55Z" }, + { url = "https://files.pythonhosted.org/packages/b9/c8/14ce60ec31a2e5f5274bb17d383a6f7a3aabca31ac04eee05585bbadab16/aiohttp-3.14.1-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:1601cc37baf5750ccacae618ec2daf020769581695550e3b654a911f859c563d", size = 532476, upload-time = "2026-06-07T21:08:57.176Z" }, + { url = "https://files.pythonhosted.org/packages/7e/02/9ac85e081e53da2e061b02fa7758fe0a12d17b8ce2d1f5e6c7cb76730328/aiohttp-3.14.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4d6e0ac9da31c9c04c84e1c0182ad8d6df35965a85cae29cd71d089621b3ae94", size = 1922347, upload-time = "2026-06-07T21:08:59.563Z" }, + { url = "https://files.pythonhosted.org/packages/c0/3e/d3ba07a0ab38b5389e10bec4362d21e10a4f667cba2d79ba30837b3a5059/aiohttp-3.14.1-cp314-cp314t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:9e8f2d660c350b3d0e259c7a7e3d9b7fc8b41210cbcc3d4a7076ff0a5e5c2fdc", size = 1786465, upload-time = "2026-06-07T21:09:01.909Z" }, + { url = "https://files.pythonhosted.org/packages/0b/cb/e2ee978a00cfb2df829704a69528b18154eba5939f45bc1efa8f33aee4c5/aiohttp-3.14.1-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:4691802dda97be727f79d86818acaad7eb8e9252626a1d6b519fedbb92d5e251", size = 1909423, upload-time = "2026-06-07T21:09:04.357Z" }, + { url = "https://files.pythonhosted.org/packages/73/5d/1430334858b1022b58ae50399a918f0bd6fe8fa7fa183598d657ff61e040/aiohttp-3.14.1-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:c389c482a7e9b9dc3ee2701ac46c4125297a3818875b9c305ddb603c04828fd1", size = 2001906, upload-time = "2026-06-07T21:09:06.722Z" }, + { url = "https://files.pythonhosted.org/packages/66/4e/560c7472d3d198a23aa5c8b19a5115bf6a9b77b7d3e4bb363da320430ad2/aiohttp-3.14.1-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:fc0cacab7ba4e56f0f81c82a98c09bed2f39c940107b03a34b168bdf7597edd3", size = 1877095, upload-time = "2026-06-07T21:09:09.011Z" }, + { url = "https://files.pythonhosted.org/packages/0d/f1/4745806578d447db4a784a8591e2dae3afdfc2bcb96f8f81271b13df6543/aiohttp-3.14.1-cp314-cp314t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:979ed4717f59b8bb12e3963378fa285d93d367e15bcd66c721311826d3c44a6c", size = 1676222, upload-time = "2026-06-07T21:09:11.461Z" }, + { url = "https://files.pythonhosted.org/packages/6a/c9/48255813cca749a229ef0ab476004ec623728ad79a9c0840616f6c076325/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:38e1e7daaea81df51c952e18483f323d878499a1e2bfe564790e0f9701d6f203", size = 1842922, upload-time = "2026-06-07T21:09:14.118Z" }, + { url = "https://files.pythonhosted.org/packages/3d/c0/bbd054e2bee909f529523a5af3891052606af5143c09f5f183ec3b234676/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:4132e72c608fe9fecb8f409113567605915b83e9bdd3ea56538d2f9cd35002f1", size = 1825035, upload-time = "2026-06-07T21:09:16.447Z" }, + { url = "https://files.pythonhosted.org/packages/a8/ae/90395d4376deceb74e09ec26b6adf7d2015a6f8802d6d84446af860fef04/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:eefd9cc9b6d4a2db5f00a26bc3e4f9acf71926a6ec557cd56c9c6f27c290b665", size = 1849512, upload-time = "2026-06-07T21:09:18.742Z" }, + { url = "https://files.pythonhosted.org/packages/93/bd/fb25f3049957553d4ce0ba6ae480aa2f592a6985497fca590837d16c1be0/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_riscv64.whl", hash = "sha256:b165790117eea512d7f3fb22f1f6dad3d55a7189571993eb015591c1401276d1", size = 1668571, upload-time = "2026-06-07T21:09:21.458Z" }, + { url = "https://files.pythonhosted.org/packages/3f/22/7f73303d64dd567ff3addca90b556690ed1233a47b8f55d242fb90af3681/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:ed09c7eb1c391271c2ed0314a51903e72a3acb653d5ccfc264cdf3ef11f8269d", size = 1881159, upload-time = "2026-06-07T21:09:23.813Z" }, + { url = "https://files.pythonhosted.org/packages/44/be/0474c5a8b5640e1e4aa1923430a91f4151be82e511373fe764189b89aef5/aiohttp-3.14.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:99abd37084b82f5830c635fddd0b4993b9742a66eb746dacf433c8590e8f9e3c", size = 1841409, upload-time = "2026-06-07T21:09:26.207Z" }, + { url = "https://files.pythonhosted.org/packages/7b/3c/bb4a7cba26956cb3da4553cc2056cf67be5b5ff6e6d8fa4fbdff73bfb7ae/aiohttp-3.14.1-cp314-cp314t-win32.whl", hash = "sha256:47ddf841cdecc810749921d25606dee45857d12d2ad5ddb7b5bd7eab12e4b365", size = 494166, upload-time = "2026-06-07T21:09:28.505Z" }, + { url = "https://files.pythonhosted.org/packages/8a/84/ec80c2c1f66a952555a9f86df6b33af65108a6febfa0471b69013a12f807/aiohttp-3.14.1-cp314-cp314t-win_amd64.whl", hash = "sha256:5e78b522b7a6e27e0b25d19b247b75039ac4c94f99823e3c9e53ae1603a9f7e9", size = 530255, upload-time = "2026-06-07T21:09:30.843Z" }, + { url = "https://files.pythonhosted.org/packages/2a/71/6e22be134a4061ada85a92951b842f2657f17d926b727f3f94c56ae963d6/aiohttp-3.14.1-cp314-cp314t-win_arm64.whl", hash = "sha256:90d53f1609c29ccc2193945ef732428382a28f78d0456ae4d3daf0d48b74f0f6", size = 469640, upload-time = "2026-06-07T21:09:33.028Z" }, +] + +[[package]] +name = "aiosignal" +version = "1.4.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "frozenlist" }, + { name = "typing-extensions", marker = "python_full_version < '3.13'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/61/62/06741b579156360248d1ec624842ad0edf697050bbaf7c3e46394e106ad1/aiosignal-1.4.0.tar.gz", hash = "sha256:f47eecd9468083c2029cc99945502cb7708b082c232f9aca65da147157b251c7", size = 25007, upload-time = "2025-07-03T22:54:43.528Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/fb/76/641ae371508676492379f16e2fa48f4e2c11741bd63c48be4b12a6b09cba/aiosignal-1.4.0-py3-none-any.whl", hash = "sha256:053243f8b92b990551949e63930a839ff0cf0b0ebbe0597b0f3fb19e1a0fe82e", size = 7490, upload-time = "2025-07-03T22:54:42.156Z" }, +] + +[[package]] +name = "alabaster" +version = "1.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/a6/f8/d9c74d0daf3f742840fd818d69cfae176fa332022fd44e3469487d5a9420/alabaster-1.0.0.tar.gz", hash = "sha256:c00dca57bca26fa62a6d7d0a9fcce65f3e026e9bfe33e9c538fd3fbb2144fd9e", size = 24210, upload-time = "2024-07-26T18:15:03.762Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/7e/b3/6b4067be973ae96ba0d615946e314c5ae35f9f993eca561b356540bb0c2b/alabaster-1.0.0-py3-none-any.whl", hash = "sha256:fc6786402dc3fcb2de3cabd5fe455a2db534b371124f1f21de8731783dec828b", size = 13929, upload-time = "2024-07-26T18:15:02.05Z" }, +] + +[[package]] +name = "altgraph" +version = "0.17.5" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/7e/f8/97fdf103f38fed6792a1601dbc16cc8aac56e7459a9fff08c812d8ae177a/altgraph-0.17.5.tar.gz", hash = "sha256:c87b395dd12fabde9c99573a9749d67da8d29ef9de0125c7f536699b4a9bc9e7", size = 48428, upload-time = "2025-11-21T20:35:50.583Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/a9/ba/000a1996d4308bc65120167c21241a3b205464a2e0b58deda26ae8ac21d1/altgraph-0.17.5-py2.py3-none-any.whl", hash = "sha256:f3a22400bce1b0c701683820ac4f3b159cd301acab067c51c653e06961600597", size = 21228, upload-time = "2025-11-21T20:35:49.444Z" }, +] + +[[package]] +name = "annotated-doc" +version = "0.0.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/57/ba/046ceea27344560984e26a590f90bc7f4a75b06701f653222458922b558c/annotated_doc-0.0.4.tar.gz", hash = "sha256:fbcda96e87e9c92ad167c2e53839e57503ecfda18804ea28102353485033faa4", size = 7288, upload-time = "2025-11-10T22:07:42.062Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1e/d3/26bf1008eb3d2daa8ef4cacc7f3bfdc11818d111f7e2d0201bc6e3b49d45/annotated_doc-0.0.4-py3-none-any.whl", hash = "sha256:571ac1dc6991c450b25a9c2d84a3705e2ae7a53467b5d111c24fa8baabbed320", size = 5303, upload-time = "2025-11-10T22:07:40.673Z" }, +] + +[[package]] +name = "annotated-types" +version = "0.7.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ee/67/531ea369ba64dcff5ec9c3402f9f51bf748cec26dde048a2f973a4eea7f5/annotated_types-0.7.0.tar.gz", hash = "sha256:aff07c09a53a08bc8cfccb9c85b05f1aa9a2a6f23728d790723543408344ce89", size = 16081, upload-time = "2024-05-20T21:33:25.928Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/78/b6/6307fbef88d9b5ee7421e68d78a9f162e0da4900bc5f5793f6d3d0e34fb8/annotated_types-0.7.0-py3-none-any.whl", hash = "sha256:1f02e8b43a8fbbc3f3e0d4f0f4bfc8131bcb4eebe8849b8e5c773f3a1c582a53", size = 13643, upload-time = "2024-05-20T21:33:24.1Z" }, +] + +[[package]] +name = "anyio" +version = "4.12.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "idna" }, + { name = "typing-extensions", marker = "python_full_version < '3.13'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/96/f0/5eb65b2bb0d09ac6776f2eb54adee6abe8228ea05b20a5ad0e4945de8aac/anyio-4.12.1.tar.gz", hash = "sha256:41cfcc3a4c85d3f05c932da7c26d0201ac36f72abd4435ba90d0464a3ffed703", size = 228685, upload-time = "2026-01-06T11:45:21.246Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/38/0e/27be9fdef66e72d64c0cdc3cc2823101b80585f8119b5c112c2e8f5f7dab/anyio-4.12.1-py3-none-any.whl", hash = "sha256:d405828884fc140aa80a3c667b8beed277f1dfedec42ba031bd6ac3db606ab6c", size = 113592, upload-time = "2026-01-06T11:45:19.497Z" }, +] + +[[package]] +name = "appnope" +version = "0.1.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/35/5d/752690df9ef5b76e169e68d6a129fa6d08a7100ca7f754c89495db3c6019/appnope-0.1.4.tar.gz", hash = "sha256:1de3860566df9caf38f01f86f65e0e13e379af54f9e4bee1e66b48f2efffd1ee", size = 4170, upload-time = "2024-02-06T09:43:11.258Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/81/29/5ecc3a15d5a33e31b26c11426c45c501e439cb865d0bff96315d86443b78/appnope-0.1.4-py2.py3-none-any.whl", hash = "sha256:502575ee11cd7a28c0205f379b525beefebab9d161b7c964670864014ed7213c", size = 4321, upload-time = "2024-02-06T09:43:09.663Z" }, +] + +[[package]] +name = "asttokens" +version = "3.0.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/be/a5/8e3f9b6771b0b408517c82d97aed8f2036509bc247d46114925e32fe33f0/asttokens-3.0.1.tar.gz", hash = "sha256:71a4ee5de0bde6a31d64f6b13f2293ac190344478f081c3d1bccfcf5eacb0cb7", size = 62308, upload-time = "2025-11-15T16:43:48.578Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d2/39/e7eaf1799466a4aef85b6a4fe7bd175ad2b1c6345066aa33f1f58d4b18d0/asttokens-3.0.1-py3-none-any.whl", hash = "sha256:15a3ebc0f43c2d0a50eeafea25e19046c68398e487b9f1f5b517f7c0f40f976a", size = 27047, upload-time = "2025-11-15T16:43:16.109Z" }, +] + +[[package]] +name = "attrs" +version = "26.1.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/9a/8e/82a0fe20a541c03148528be8cac2408564a6c9a0cc7e9171802bc1d26985/attrs-26.1.0.tar.gz", hash = "sha256:d03ceb89cb322a8fd706d4fb91940737b6642aa36998fe130a9bc96c985eff32", size = 952055, upload-time = "2026-03-19T14:22:25.026Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/64/b4/17d4b0b2a2dc85a6df63d1157e028ed19f90d4cd97c36717afef2bc2f395/attrs-26.1.0-py3-none-any.whl", hash = "sha256:c647aa4a12dfbad9333ca4e71fe62ddc36f4e63b2d260a37a8b83d2f043ac309", size = 67548, upload-time = "2026-03-19T14:22:23.645Z" }, +] + +[[package]] +name = "babel" +version = "2.18.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/7d/b2/51899539b6ceeeb420d40ed3cd4b7a40519404f9baf3d4ac99dc413a834b/babel-2.18.0.tar.gz", hash = "sha256:b80b99a14bd085fcacfa15c9165f651fbb3406e66cc603abf11c5750937c992d", size = 9959554, upload-time = "2026-02-01T12:30:56.078Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/77/f5/21d2de20e8b8b0408f0681956ca2c69f1320a3848ac50e6e7f39c6159675/babel-2.18.0-py3-none-any.whl", hash = "sha256:e2b422b277c2b9a9630c1d7903c2a00d0830c409c59ac8cae9081c92f1aeba35", size = 10196845, upload-time = "2026-02-01T12:30:53.445Z" }, +] + +[[package]] +name = "bidict" +version = "0.23.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/9a/6e/026678aa5a830e07cd9498a05d3e7e650a4f56a42f267a53d22bcda1bdc9/bidict-0.23.1.tar.gz", hash = "sha256:03069d763bc387bbd20e7d49914e75fc4132a41937fa3405417e1a5a2d006d71", size = 29093, upload-time = "2024-02-18T19:09:05.748Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/99/37/e8730c3587a65eb5645d4aba2d27aae48e8003614d6aaf15dda67f702f1f/bidict-0.23.1-py3-none-any.whl", hash = "sha256:5dae8d4d79b552a71cbabc7deb25dfe8ce710b17ff41711e13010ead2abfc3e5", size = 32764, upload-time = "2024-02-18T19:09:04.156Z" }, +] + +[[package]] +name = "bottle" +version = "0.13.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/7a/71/cca6167c06d00c81375fd668719df245864076d284f7cb46a694cbeb5454/bottle-0.13.4.tar.gz", hash = "sha256:787e78327e12b227938de02248333d788cfe45987edca735f8f88e03472c3f47", size = 98717, upload-time = "2025-06-15T10:08:59.439Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/83/f6/b55ec74cfe68c6584163faa311503c20b0da4c09883a41e8e00d6726c954/bottle-0.13.4-py2.py3-none-any.whl", hash = "sha256:045684fbd2764eac9cdeb824861d1551d113e8b683d8d26e296898d3dd99a12e", size = 103807, upload-time = "2025-06-15T10:08:57.691Z" }, +] + +[[package]] +name = "certifi" +version = "2026.1.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/e0/2d/a891ca51311197f6ad14a7ef42e2399f36cf2f9bd44752b3dc4eab60fdc5/certifi-2026.1.4.tar.gz", hash = "sha256:ac726dd470482006e014ad384921ed6438c457018f4b3d204aea4281258b2120", size = 154268, upload-time = "2026-01-04T02:42:41.825Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e6/ad/3cc14f097111b4de0040c83a525973216457bbeeb63739ef1ed275c1c021/certifi-2026.1.4-py3-none-any.whl", hash = "sha256:9943707519e4add1115f44c2bc244f782c0249876bf51b6599fee1ffbedd685c", size = 152900, upload-time = "2026-01-04T02:42:40.15Z" }, +] + +[[package]] +name = "cffi" +version = "2.0.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pycparser", marker = "implementation_name != 'PyPy'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/eb/56/b1ba7935a17738ae8453301356628e8147c79dbb825bcbc73dc7401f9846/cffi-2.0.0.tar.gz", hash = "sha256:44d1b5909021139fe36001ae048dbdde8214afa20200eda0f64c068cac5d5529", size = 523588, upload-time = "2025-09-08T23:24:04.541Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/12/4a/3dfd5f7850cbf0d06dc84ba9aa00db766b52ca38d8b86e3a38314d52498c/cffi-2.0.0-cp311-cp311-macosx_10_13_x86_64.whl", hash = "sha256:b4c854ef3adc177950a8dfc81a86f5115d2abd545751a304c5bcf2c2c7283cfe", size = 184344, upload-time = "2025-09-08T23:22:26.456Z" }, + { url = "https://files.pythonhosted.org/packages/4f/8b/f0e4c441227ba756aafbe78f117485b25bb26b1c059d01f137fa6d14896b/cffi-2.0.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:2de9a304e27f7596cd03d16f1b7c72219bd944e99cc52b84d0145aefb07cbd3c", size = 180560, upload-time = "2025-09-08T23:22:28.197Z" }, + { url = "https://files.pythonhosted.org/packages/b1/b7/1200d354378ef52ec227395d95c2576330fd22a869f7a70e88e1447eb234/cffi-2.0.0-cp311-cp311-manylinux1_i686.manylinux2014_i686.manylinux_2_17_i686.manylinux_2_5_i686.whl", hash = "sha256:baf5215e0ab74c16e2dd324e8ec067ef59e41125d3eade2b863d294fd5035c92", size = 209613, upload-time = "2025-09-08T23:22:29.475Z" }, + { url = "https://files.pythonhosted.org/packages/b8/56/6033f5e86e8cc9bb629f0077ba71679508bdf54a9a5e112a3c0b91870332/cffi-2.0.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:730cacb21e1bdff3ce90babf007d0a0917cc3e6492f336c2f0134101e0944f93", size = 216476, upload-time = "2025-09-08T23:22:31.063Z" }, + { url = "https://files.pythonhosted.org/packages/dc/7f/55fecd70f7ece178db2f26128ec41430d8720f2d12ca97bf8f0a628207d5/cffi-2.0.0-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.whl", hash = "sha256:6824f87845e3396029f3820c206e459ccc91760e8fa24422f8b0c3d1731cbec5", size = 203374, upload-time = "2025-09-08T23:22:32.507Z" }, + { url = "https://files.pythonhosted.org/packages/84/ef/a7b77c8bdc0f77adc3b46888f1ad54be8f3b7821697a7b89126e829e676a/cffi-2.0.0-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.whl", hash = "sha256:9de40a7b0323d889cf8d23d1ef214f565ab154443c42737dfe52ff82cf857664", size = 202597, upload-time = "2025-09-08T23:22:34.132Z" }, + { url = "https://files.pythonhosted.org/packages/d7/91/500d892b2bf36529a75b77958edfcd5ad8e2ce4064ce2ecfeab2125d72d1/cffi-2.0.0-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:8941aaadaf67246224cee8c3803777eed332a19d909b47e29c9842ef1e79ac26", size = 215574, upload-time = "2025-09-08T23:22:35.443Z" }, + { url = "https://files.pythonhosted.org/packages/44/64/58f6255b62b101093d5df22dcb752596066c7e89dd725e0afaed242a61be/cffi-2.0.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:a05d0c237b3349096d3981b727493e22147f934b20f6f125a3eba8f994bec4a9", size = 218971, upload-time = "2025-09-08T23:22:36.805Z" }, + { url = "https://files.pythonhosted.org/packages/ab/49/fa72cebe2fd8a55fbe14956f9970fe8eb1ac59e5df042f603ef7c8ba0adc/cffi-2.0.0-cp311-cp311-musllinux_1_2_i686.whl", hash = "sha256:94698a9c5f91f9d138526b48fe26a199609544591f859c870d477351dc7b2414", size = 211972, upload-time = "2025-09-08T23:22:38.436Z" }, + { url = "https://files.pythonhosted.org/packages/0b/28/dd0967a76aab36731b6ebfe64dec4e981aff7e0608f60c2d46b46982607d/cffi-2.0.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:5fed36fccc0612a53f1d4d9a816b50a36702c28a2aa880cb8a122b3466638743", size = 217078, upload-time = "2025-09-08T23:22:39.776Z" }, + { url = "https://files.pythonhosted.org/packages/2b/c0/015b25184413d7ab0a410775fdb4a50fca20f5589b5dab1dbbfa3baad8ce/cffi-2.0.0-cp311-cp311-win32.whl", hash = "sha256:c649e3a33450ec82378822b3dad03cc228b8f5963c0c12fc3b1e0ab940f768a5", size = 172076, upload-time = "2025-09-08T23:22:40.95Z" }, + { url = "https://files.pythonhosted.org/packages/ae/8f/dc5531155e7070361eb1b7e4c1a9d896d0cb21c49f807a6c03fd63fc877e/cffi-2.0.0-cp311-cp311-win_amd64.whl", hash = "sha256:66f011380d0e49ed280c789fbd08ff0d40968ee7b665575489afa95c98196ab5", size = 182820, upload-time = "2025-09-08T23:22:42.463Z" }, + { url = "https://files.pythonhosted.org/packages/95/5c/1b493356429f9aecfd56bc171285a4c4ac8697f76e9bbbbb105e537853a1/cffi-2.0.0-cp311-cp311-win_arm64.whl", hash = "sha256:c6638687455baf640e37344fe26d37c404db8b80d037c3d29f58fe8d1c3b194d", size = 177635, upload-time = "2025-09-08T23:22:43.623Z" }, + { url = "https://files.pythonhosted.org/packages/ea/47/4f61023ea636104d4f16ab488e268b93008c3d0bb76893b1b31db1f96802/cffi-2.0.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:6d02d6655b0e54f54c4ef0b94eb6be0607b70853c45ce98bd278dc7de718be5d", size = 185271, upload-time = "2025-09-08T23:22:44.795Z" }, + { url = "https://files.pythonhosted.org/packages/df/a2/781b623f57358e360d62cdd7a8c681f074a71d445418a776eef0aadb4ab4/cffi-2.0.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:8eca2a813c1cb7ad4fb74d368c2ffbbb4789d377ee5bb8df98373c2cc0dee76c", size = 181048, upload-time = "2025-09-08T23:22:45.938Z" }, + { url = "https://files.pythonhosted.org/packages/ff/df/a4f0fbd47331ceeba3d37c2e51e9dfc9722498becbeec2bd8bc856c9538a/cffi-2.0.0-cp312-cp312-manylinux1_i686.manylinux2014_i686.manylinux_2_17_i686.manylinux_2_5_i686.whl", hash = "sha256:21d1152871b019407d8ac3985f6775c079416c282e431a4da6afe7aefd2bccbe", size = 212529, upload-time = "2025-09-08T23:22:47.349Z" }, + { url = "https://files.pythonhosted.org/packages/d5/72/12b5f8d3865bf0f87cf1404d8c374e7487dcf097a1c91c436e72e6badd83/cffi-2.0.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:b21e08af67b8a103c71a250401c78d5e0893beff75e28c53c98f4de42f774062", size = 220097, upload-time = "2025-09-08T23:22:48.677Z" }, + { url = "https://files.pythonhosted.org/packages/c2/95/7a135d52a50dfa7c882ab0ac17e8dc11cec9d55d2c18dda414c051c5e69e/cffi-2.0.0-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.whl", hash = "sha256:1e3a615586f05fc4065a8b22b8152f0c1b00cdbc60596d187c2a74f9e3036e4e", size = 207983, upload-time = "2025-09-08T23:22:50.06Z" }, + { url = "https://files.pythonhosted.org/packages/3a/c8/15cb9ada8895957ea171c62dc78ff3e99159ee7adb13c0123c001a2546c1/cffi-2.0.0-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.whl", hash = "sha256:81afed14892743bbe14dacb9e36d9e0e504cd204e0b165062c488942b9718037", size = 206519, upload-time = "2025-09-08T23:22:51.364Z" }, + { url = "https://files.pythonhosted.org/packages/78/2d/7fa73dfa841b5ac06c7b8855cfc18622132e365f5b81d02230333ff26e9e/cffi-2.0.0-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:3e17ed538242334bf70832644a32a7aae3d83b57567f9fd60a26257e992b79ba", size = 219572, upload-time = "2025-09-08T23:22:52.902Z" }, + { url = "https://files.pythonhosted.org/packages/07/e0/267e57e387b4ca276b90f0434ff88b2c2241ad72b16d31836adddfd6031b/cffi-2.0.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:3925dd22fa2b7699ed2617149842d2e6adde22b262fcbfada50e3d195e4b3a94", size = 222963, upload-time = "2025-09-08T23:22:54.518Z" }, + { url = "https://files.pythonhosted.org/packages/b6/75/1f2747525e06f53efbd878f4d03bac5b859cbc11c633d0fb81432d98a795/cffi-2.0.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:2c8f814d84194c9ea681642fd164267891702542f028a15fc97d4674b6206187", size = 221361, upload-time = "2025-09-08T23:22:55.867Z" }, + { url = "https://files.pythonhosted.org/packages/7b/2b/2b6435f76bfeb6bbf055596976da087377ede68df465419d192acf00c437/cffi-2.0.0-cp312-cp312-win32.whl", hash = "sha256:da902562c3e9c550df360bfa53c035b2f241fed6d9aef119048073680ace4a18", size = 172932, upload-time = "2025-09-08T23:22:57.188Z" }, + { url = "https://files.pythonhosted.org/packages/f8/ed/13bd4418627013bec4ed6e54283b1959cf6db888048c7cf4b4c3b5b36002/cffi-2.0.0-cp312-cp312-win_amd64.whl", hash = "sha256:da68248800ad6320861f129cd9c1bf96ca849a2771a59e0344e88681905916f5", size = 183557, upload-time = "2025-09-08T23:22:58.351Z" }, + { url = "https://files.pythonhosted.org/packages/95/31/9f7f93ad2f8eff1dbc1c3656d7ca5bfd8fb52c9d786b4dcf19b2d02217fa/cffi-2.0.0-cp312-cp312-win_arm64.whl", hash = "sha256:4671d9dd5ec934cb9a73e7ee9676f9362aba54f7f34910956b84d727b0d73fb6", size = 177762, upload-time = "2025-09-08T23:22:59.668Z" }, + { url = "https://files.pythonhosted.org/packages/4b/8d/a0a47a0c9e413a658623d014e91e74a50cdd2c423f7ccfd44086ef767f90/cffi-2.0.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:00bdf7acc5f795150faa6957054fbbca2439db2f775ce831222b66f192f03beb", size = 185230, upload-time = "2025-09-08T23:23:00.879Z" }, + { url = "https://files.pythonhosted.org/packages/4a/d2/a6c0296814556c68ee32009d9c2ad4f85f2707cdecfd7727951ec228005d/cffi-2.0.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:45d5e886156860dc35862657e1494b9bae8dfa63bf56796f2fb56e1679fc0bca", size = 181043, upload-time = "2025-09-08T23:23:02.231Z" }, + { url = "https://files.pythonhosted.org/packages/b0/1e/d22cc63332bd59b06481ceaac49d6c507598642e2230f201649058a7e704/cffi-2.0.0-cp313-cp313-manylinux1_i686.manylinux2014_i686.manylinux_2_17_i686.manylinux_2_5_i686.whl", hash = "sha256:07b271772c100085dd28b74fa0cd81c8fb1a3ba18b21e03d7c27f3436a10606b", size = 212446, upload-time = "2025-09-08T23:23:03.472Z" }, + { url = "https://files.pythonhosted.org/packages/a9/f5/a2c23eb03b61a0b8747f211eb716446c826ad66818ddc7810cc2cc19b3f2/cffi-2.0.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:d48a880098c96020b02d5a1f7d9251308510ce8858940e6fa99ece33f610838b", size = 220101, upload-time = "2025-09-08T23:23:04.792Z" }, + { url = "https://files.pythonhosted.org/packages/f2/7f/e6647792fc5850d634695bc0e6ab4111ae88e89981d35ac269956605feba/cffi-2.0.0-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.whl", hash = "sha256:f93fd8e5c8c0a4aa1f424d6173f14a892044054871c771f8566e4008eaa359d2", size = 207948, upload-time = "2025-09-08T23:23:06.127Z" }, + { url = "https://files.pythonhosted.org/packages/cb/1e/a5a1bd6f1fb30f22573f76533de12a00bf274abcdc55c8edab639078abb6/cffi-2.0.0-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.whl", hash = "sha256:dd4f05f54a52fb558f1ba9f528228066954fee3ebe629fc1660d874d040ae5a3", size = 206422, upload-time = "2025-09-08T23:23:07.753Z" }, + { url = "https://files.pythonhosted.org/packages/98/df/0a1755e750013a2081e863e7cd37e0cdd02664372c754e5560099eb7aa44/cffi-2.0.0-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:c8d3b5532fc71b7a77c09192b4a5a200ea992702734a2e9279a37f2478236f26", size = 219499, upload-time = "2025-09-08T23:23:09.648Z" }, + { url = "https://files.pythonhosted.org/packages/50/e1/a969e687fcf9ea58e6e2a928ad5e2dd88cc12f6f0ab477e9971f2309b57c/cffi-2.0.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:d9b29c1f0ae438d5ee9acb31cadee00a58c46cc9c0b2f9038c6b0b3470877a8c", size = 222928, upload-time = "2025-09-08T23:23:10.928Z" }, + { url = "https://files.pythonhosted.org/packages/36/54/0362578dd2c9e557a28ac77698ed67323ed5b9775ca9d3fe73fe191bb5d8/cffi-2.0.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:6d50360be4546678fc1b79ffe7a66265e28667840010348dd69a314145807a1b", size = 221302, upload-time = "2025-09-08T23:23:12.42Z" }, + { url = "https://files.pythonhosted.org/packages/eb/6d/bf9bda840d5f1dfdbf0feca87fbdb64a918a69bca42cfa0ba7b137c48cb8/cffi-2.0.0-cp313-cp313-win32.whl", hash = "sha256:74a03b9698e198d47562765773b4a8309919089150a0bb17d829ad7b44b60d27", size = 172909, upload-time = "2025-09-08T23:23:14.32Z" }, + { url = "https://files.pythonhosted.org/packages/37/18/6519e1ee6f5a1e579e04b9ddb6f1676c17368a7aba48299c3759bbc3c8b3/cffi-2.0.0-cp313-cp313-win_amd64.whl", hash = "sha256:19f705ada2530c1167abacb171925dd886168931e0a7b78f5bffcae5c6b5be75", size = 183402, upload-time = "2025-09-08T23:23:15.535Z" }, + { url = "https://files.pythonhosted.org/packages/cb/0e/02ceeec9a7d6ee63bb596121c2c8e9b3a9e150936f4fbef6ca1943e6137c/cffi-2.0.0-cp313-cp313-win_arm64.whl", hash = "sha256:256f80b80ca3853f90c21b23ee78cd008713787b1b1e93eae9f3d6a7134abd91", size = 177780, upload-time = "2025-09-08T23:23:16.761Z" }, + { url = "https://files.pythonhosted.org/packages/92/c4/3ce07396253a83250ee98564f8d7e9789fab8e58858f35d07a9a2c78de9f/cffi-2.0.0-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:fc33c5141b55ed366cfaad382df24fe7dcbc686de5be719b207bb248e3053dc5", size = 185320, upload-time = "2025-09-08T23:23:18.087Z" }, + { url = "https://files.pythonhosted.org/packages/59/dd/27e9fa567a23931c838c6b02d0764611c62290062a6d4e8ff7863daf9730/cffi-2.0.0-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:c654de545946e0db659b3400168c9ad31b5d29593291482c43e3564effbcee13", size = 181487, upload-time = "2025-09-08T23:23:19.622Z" }, + { url = "https://files.pythonhosted.org/packages/d6/43/0e822876f87ea8a4ef95442c3d766a06a51fc5298823f884ef87aaad168c/cffi-2.0.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:24b6f81f1983e6df8db3adc38562c83f7d4a0c36162885ec7f7b77c7dcbec97b", size = 220049, upload-time = "2025-09-08T23:23:20.853Z" }, + { url = "https://files.pythonhosted.org/packages/b4/89/76799151d9c2d2d1ead63c2429da9ea9d7aac304603de0c6e8764e6e8e70/cffi-2.0.0-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.whl", hash = "sha256:12873ca6cb9b0f0d3a0da705d6086fe911591737a59f28b7936bdfed27c0d47c", size = 207793, upload-time = "2025-09-08T23:23:22.08Z" }, + { url = "https://files.pythonhosted.org/packages/bb/dd/3465b14bb9e24ee24cb88c9e3730f6de63111fffe513492bf8c808a3547e/cffi-2.0.0-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.whl", hash = "sha256:d9b97165e8aed9272a6bb17c01e3cc5871a594a446ebedc996e2397a1c1ea8ef", size = 206300, upload-time = "2025-09-08T23:23:23.314Z" }, + { url = "https://files.pythonhosted.org/packages/47/d9/d83e293854571c877a92da46fdec39158f8d7e68da75bf73581225d28e90/cffi-2.0.0-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:afb8db5439b81cf9c9d0c80404b60c3cc9c3add93e114dcae767f1477cb53775", size = 219244, upload-time = "2025-09-08T23:23:24.541Z" }, + { url = "https://files.pythonhosted.org/packages/2b/0f/1f177e3683aead2bb00f7679a16451d302c436b5cbf2505f0ea8146ef59e/cffi-2.0.0-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:737fe7d37e1a1bffe70bd5754ea763a62a066dc5913ca57e957824b72a85e205", size = 222828, upload-time = "2025-09-08T23:23:26.143Z" }, + { url = "https://files.pythonhosted.org/packages/c6/0f/cafacebd4b040e3119dcb32fed8bdef8dfe94da653155f9d0b9dc660166e/cffi-2.0.0-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:38100abb9d1b1435bc4cc340bb4489635dc2f0da7456590877030c9b3d40b0c1", size = 220926, upload-time = "2025-09-08T23:23:27.873Z" }, + { url = "https://files.pythonhosted.org/packages/3e/aa/df335faa45b395396fcbc03de2dfcab242cd61a9900e914fe682a59170b1/cffi-2.0.0-cp314-cp314-win32.whl", hash = "sha256:087067fa8953339c723661eda6b54bc98c5625757ea62e95eb4898ad5e776e9f", size = 175328, upload-time = "2025-09-08T23:23:44.61Z" }, + { url = "https://files.pythonhosted.org/packages/bb/92/882c2d30831744296ce713f0feb4c1cd30f346ef747b530b5318715cc367/cffi-2.0.0-cp314-cp314-win_amd64.whl", hash = "sha256:203a48d1fb583fc7d78a4c6655692963b860a417c0528492a6bc21f1aaefab25", size = 185650, upload-time = "2025-09-08T23:23:45.848Z" }, + { url = "https://files.pythonhosted.org/packages/9f/2c/98ece204b9d35a7366b5b2c6539c350313ca13932143e79dc133ba757104/cffi-2.0.0-cp314-cp314-win_arm64.whl", hash = "sha256:dbd5c7a25a7cb98f5ca55d258b103a2054f859a46ae11aaf23134f9cc0d356ad", size = 180687, upload-time = "2025-09-08T23:23:47.105Z" }, + { url = "https://files.pythonhosted.org/packages/3e/61/c768e4d548bfa607abcda77423448df8c471f25dbe64fb2ef6d555eae006/cffi-2.0.0-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:9a67fc9e8eb39039280526379fb3a70023d77caec1852002b4da7e8b270c4dd9", size = 188773, upload-time = "2025-09-08T23:23:29.347Z" }, + { url = "https://files.pythonhosted.org/packages/2c/ea/5f76bce7cf6fcd0ab1a1058b5af899bfbef198bea4d5686da88471ea0336/cffi-2.0.0-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:7a66c7204d8869299919db4d5069a82f1561581af12b11b3c9f48c584eb8743d", size = 185013, upload-time = "2025-09-08T23:23:30.63Z" }, + { url = "https://files.pythonhosted.org/packages/be/b4/c56878d0d1755cf9caa54ba71e5d049479c52f9e4afc230f06822162ab2f/cffi-2.0.0-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:7cc09976e8b56f8cebd752f7113ad07752461f48a58cbba644139015ac24954c", size = 221593, upload-time = "2025-09-08T23:23:31.91Z" }, + { url = "https://files.pythonhosted.org/packages/e0/0d/eb704606dfe8033e7128df5e90fee946bbcb64a04fcdaa97321309004000/cffi-2.0.0-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.whl", hash = "sha256:92b68146a71df78564e4ef48af17551a5ddd142e5190cdf2c5624d0c3ff5b2e8", size = 209354, upload-time = "2025-09-08T23:23:33.214Z" }, + { url = "https://files.pythonhosted.org/packages/d8/19/3c435d727b368ca475fb8742ab97c9cb13a0de600ce86f62eab7fa3eea60/cffi-2.0.0-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.whl", hash = "sha256:b1e74d11748e7e98e2f426ab176d4ed720a64412b6a15054378afdb71e0f37dc", size = 208480, upload-time = "2025-09-08T23:23:34.495Z" }, + { url = "https://files.pythonhosted.org/packages/d0/44/681604464ed9541673e486521497406fadcc15b5217c3e326b061696899a/cffi-2.0.0-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:28a3a209b96630bca57cce802da70c266eb08c6e97e5afd61a75611ee6c64592", size = 221584, upload-time = "2025-09-08T23:23:36.096Z" }, + { url = "https://files.pythonhosted.org/packages/25/8e/342a504ff018a2825d395d44d63a767dd8ebc927ebda557fecdaca3ac33a/cffi-2.0.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:7553fb2090d71822f02c629afe6042c299edf91ba1bf94951165613553984512", size = 224443, upload-time = "2025-09-08T23:23:37.328Z" }, + { url = "https://files.pythonhosted.org/packages/e1/5e/b666bacbbc60fbf415ba9988324a132c9a7a0448a9a8f125074671c0f2c3/cffi-2.0.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:6c6c373cfc5c83a975506110d17457138c8c63016b563cc9ed6e056a82f13ce4", size = 223437, upload-time = "2025-09-08T23:23:38.945Z" }, + { url = "https://files.pythonhosted.org/packages/a0/1d/ec1a60bd1a10daa292d3cd6bb0b359a81607154fb8165f3ec95fe003b85c/cffi-2.0.0-cp314-cp314t-win32.whl", hash = "sha256:1fc9ea04857caf665289b7a75923f2c6ed559b8298a1b8c49e59f7dd95c8481e", size = 180487, upload-time = "2025-09-08T23:23:40.423Z" }, + { url = "https://files.pythonhosted.org/packages/bf/41/4c1168c74fac325c0c8156f04b6749c8b6a8f405bbf91413ba088359f60d/cffi-2.0.0-cp314-cp314t-win_amd64.whl", hash = "sha256:d68b6cef7827e8641e8ef16f4494edda8b36104d79773a334beaa1e3521430f6", size = 191726, upload-time = "2025-09-08T23:23:41.742Z" }, + { url = "https://files.pythonhosted.org/packages/ae/3a/dbeec9d1ee0844c679f6bb5d6ad4e9f198b1224f4e7a32825f47f6192b0c/cffi-2.0.0-cp314-cp314t-win_arm64.whl", hash = "sha256:0a1527a803f0a659de1af2e1fd700213caba79377e27e4693648c2923da066f9", size = 184195, upload-time = "2025-09-08T23:23:43.004Z" }, +] + +[[package]] +name = "charset-normalizer" +version = "3.4.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/13/69/33ddede1939fdd074bce5434295f38fae7136463422fe4fd3e0e89b98062/charset_normalizer-3.4.4.tar.gz", hash = "sha256:94537985111c35f28720e43603b8e7b43a6ecfb2ce1d3058bbe955b73404e21a", size = 129418, upload-time = "2025-10-14T04:42:32.879Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ed/27/c6491ff4954e58a10f69ad90aca8a1b6fe9c5d3c6f380907af3c37435b59/charset_normalizer-3.4.4-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:6e1fcf0720908f200cd21aa4e6750a48ff6ce4afe7ff5a79a90d5ed8a08296f8", size = 206988, upload-time = "2025-10-14T04:40:33.79Z" }, + { url = "https://files.pythonhosted.org/packages/94/59/2e87300fe67ab820b5428580a53cad894272dbb97f38a7a814a2a1ac1011/charset_normalizer-3.4.4-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5f819d5fe9234f9f82d75bdfa9aef3a3d72c4d24a6e57aeaebba32a704553aa0", size = 147324, upload-time = "2025-10-14T04:40:34.961Z" }, + { url = "https://files.pythonhosted.org/packages/07/fb/0cf61dc84b2b088391830f6274cb57c82e4da8bbc2efeac8c025edb88772/charset_normalizer-3.4.4-cp311-cp311-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:a59cb51917aa591b1c4e6a43c132f0cdc3c76dbad6155df4e28ee626cc77a0a3", size = 142742, upload-time = "2025-10-14T04:40:36.105Z" }, + { url = "https://files.pythonhosted.org/packages/62/8b/171935adf2312cd745d290ed93cf16cf0dfe320863ab7cbeeae1dcd6535f/charset_normalizer-3.4.4-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:8ef3c867360f88ac904fd3f5e1f902f13307af9052646963ee08ff4f131adafc", size = 160863, upload-time = "2025-10-14T04:40:37.188Z" }, + { url = "https://files.pythonhosted.org/packages/09/73/ad875b192bda14f2173bfc1bc9a55e009808484a4b256748d931b6948442/charset_normalizer-3.4.4-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:d9e45d7faa48ee908174d8fe84854479ef838fc6a705c9315372eacbc2f02897", size = 157837, upload-time = "2025-10-14T04:40:38.435Z" }, + { url = "https://files.pythonhosted.org/packages/6d/fc/de9cce525b2c5b94b47c70a4b4fb19f871b24995c728e957ee68ab1671ea/charset_normalizer-3.4.4-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:840c25fb618a231545cbab0564a799f101b63b9901f2569faecd6b222ac72381", size = 151550, upload-time = "2025-10-14T04:40:40.053Z" }, + { url = "https://files.pythonhosted.org/packages/55/c2/43edd615fdfba8c6f2dfbd459b25a6b3b551f24ea21981e23fb768503ce1/charset_normalizer-3.4.4-cp311-cp311-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:ca5862d5b3928c4940729dacc329aa9102900382fea192fc5e52eb69d6093815", size = 149162, upload-time = "2025-10-14T04:40:41.163Z" }, + { url = "https://files.pythonhosted.org/packages/03/86/bde4ad8b4d0e9429a4e82c1e8f5c659993a9a863ad62c7df05cf7b678d75/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:d9c7f57c3d666a53421049053eaacdd14bbd0a528e2186fcb2e672effd053bb0", size = 150019, upload-time = "2025-10-14T04:40:42.276Z" }, + { url = "https://files.pythonhosted.org/packages/1f/86/a151eb2af293a7e7bac3a739b81072585ce36ccfb4493039f49f1d3cae8c/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:277e970e750505ed74c832b4bf75dac7476262ee2a013f5574dd49075879e161", size = 143310, upload-time = "2025-10-14T04:40:43.439Z" }, + { url = "https://files.pythonhosted.org/packages/b5/fe/43dae6144a7e07b87478fdfc4dbe9efd5defb0e7ec29f5f58a55aeef7bf7/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:31fd66405eaf47bb62e8cd575dc621c56c668f27d46a61d975a249930dd5e2a4", size = 162022, upload-time = "2025-10-14T04:40:44.547Z" }, + { url = "https://files.pythonhosted.org/packages/80/e6/7aab83774f5d2bca81f42ac58d04caf44f0cc2b65fc6db2b3b2e8a05f3b3/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:0d3d8f15c07f86e9ff82319b3d9ef6f4bf907608f53fe9d92b28ea9ae3d1fd89", size = 149383, upload-time = "2025-10-14T04:40:46.018Z" }, + { url = "https://files.pythonhosted.org/packages/4f/e8/b289173b4edae05c0dde07f69f8db476a0b511eac556dfe0d6bda3c43384/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:9f7fcd74d410a36883701fafa2482a6af2ff5ba96b9a620e9e0721e28ead5569", size = 159098, upload-time = "2025-10-14T04:40:47.081Z" }, + { url = "https://files.pythonhosted.org/packages/d8/df/fe699727754cae3f8478493c7f45f777b17c3ef0600e28abfec8619eb49c/charset_normalizer-3.4.4-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:ebf3e58c7ec8a8bed6d66a75d7fb37b55e5015b03ceae72a8e7c74495551e224", size = 152991, upload-time = "2025-10-14T04:40:48.246Z" }, + { url = "https://files.pythonhosted.org/packages/1a/86/584869fe4ddb6ffa3bd9f491b87a01568797fb9bd8933f557dba9771beaf/charset_normalizer-3.4.4-cp311-cp311-win32.whl", hash = "sha256:eecbc200c7fd5ddb9a7f16c7decb07b566c29fa2161a16cf67b8d068bd21690a", size = 99456, upload-time = "2025-10-14T04:40:49.376Z" }, + { url = "https://files.pythonhosted.org/packages/65/f6/62fdd5feb60530f50f7e38b4f6a1d5203f4d16ff4f9f0952962c044e919a/charset_normalizer-3.4.4-cp311-cp311-win_amd64.whl", hash = "sha256:5ae497466c7901d54b639cf42d5b8c1b6a4fead55215500d2f486d34db48d016", size = 106978, upload-time = "2025-10-14T04:40:50.844Z" }, + { url = "https://files.pythonhosted.org/packages/7a/9d/0710916e6c82948b3be62d9d398cb4fcf4e97b56d6a6aeccd66c4b2f2bd5/charset_normalizer-3.4.4-cp311-cp311-win_arm64.whl", hash = "sha256:65e2befcd84bc6f37095f5961e68a6f077bf44946771354a28ad434c2cce0ae1", size = 99969, upload-time = "2025-10-14T04:40:52.272Z" }, + { url = "https://files.pythonhosted.org/packages/f3/85/1637cd4af66fa687396e757dec650f28025f2a2f5a5531a3208dc0ec43f2/charset_normalizer-3.4.4-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:0a98e6759f854bd25a58a73fa88833fba3b7c491169f86ce1180c948ab3fd394", size = 208425, upload-time = "2025-10-14T04:40:53.353Z" }, + { url = "https://files.pythonhosted.org/packages/9d/6a/04130023fef2a0d9c62d0bae2649b69f7b7d8d24ea5536feef50551029df/charset_normalizer-3.4.4-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b5b290ccc2a263e8d185130284f8501e3e36c5e02750fc6b6bdeb2e9e96f1e25", size = 148162, upload-time = "2025-10-14T04:40:54.558Z" }, + { url = "https://files.pythonhosted.org/packages/78/29/62328d79aa60da22c9e0b9a66539feae06ca0f5a4171ac4f7dc285b83688/charset_normalizer-3.4.4-cp312-cp312-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:74bb723680f9f7a6234dcf67aea57e708ec1fbdf5699fb91dfd6f511b0a320ef", size = 144558, upload-time = "2025-10-14T04:40:55.677Z" }, + { url = "https://files.pythonhosted.org/packages/86/bb/b32194a4bf15b88403537c2e120b817c61cd4ecffa9b6876e941c3ee38fe/charset_normalizer-3.4.4-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f1e34719c6ed0b92f418c7c780480b26b5d9c50349e9a9af7d76bf757530350d", size = 161497, upload-time = "2025-10-14T04:40:57.217Z" }, + { url = "https://files.pythonhosted.org/packages/19/89/a54c82b253d5b9b111dc74aca196ba5ccfcca8242d0fb64146d4d3183ff1/charset_normalizer-3.4.4-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:2437418e20515acec67d86e12bf70056a33abdacb5cb1655042f6538d6b085a8", size = 159240, upload-time = "2025-10-14T04:40:58.358Z" }, + { url = "https://files.pythonhosted.org/packages/c0/10/d20b513afe03acc89ec33948320a5544d31f21b05368436d580dec4e234d/charset_normalizer-3.4.4-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:11d694519d7f29d6cd09f6ac70028dba10f92f6cdd059096db198c283794ac86", size = 153471, upload-time = "2025-10-14T04:40:59.468Z" }, + { url = "https://files.pythonhosted.org/packages/61/fa/fbf177b55bdd727010f9c0a3c49eefa1d10f960e5f09d1d887bf93c2e698/charset_normalizer-3.4.4-cp312-cp312-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:ac1c4a689edcc530fc9d9aa11f5774b9e2f33f9a0c6a57864e90908f5208d30a", size = 150864, upload-time = "2025-10-14T04:41:00.623Z" }, + { url = "https://files.pythonhosted.org/packages/05/12/9fbc6a4d39c0198adeebbde20b619790e9236557ca59fc40e0e3cebe6f40/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:21d142cc6c0ec30d2efee5068ca36c128a30b0f2c53c1c07bd78cb6bc1d3be5f", size = 150647, upload-time = "2025-10-14T04:41:01.754Z" }, + { url = "https://files.pythonhosted.org/packages/ad/1f/6a9a593d52e3e8c5d2b167daf8c6b968808efb57ef4c210acb907c365bc4/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:5dbe56a36425d26d6cfb40ce79c314a2e4dd6211d51d6d2191c00bed34f354cc", size = 145110, upload-time = "2025-10-14T04:41:03.231Z" }, + { url = "https://files.pythonhosted.org/packages/30/42/9a52c609e72471b0fc54386dc63c3781a387bb4fe61c20231a4ebcd58bdd/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:5bfbb1b9acf3334612667b61bd3002196fe2a1eb4dd74d247e0f2a4d50ec9bbf", size = 162839, upload-time = "2025-10-14T04:41:04.715Z" }, + { url = "https://files.pythonhosted.org/packages/c4/5b/c0682bbf9f11597073052628ddd38344a3d673fda35a36773f7d19344b23/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:d055ec1e26e441f6187acf818b73564e6e6282709e9bcb5b63f5b23068356a15", size = 150667, upload-time = "2025-10-14T04:41:05.827Z" }, + { url = "https://files.pythonhosted.org/packages/e4/24/a41afeab6f990cf2daf6cb8c67419b63b48cf518e4f56022230840c9bfb2/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:af2d8c67d8e573d6de5bc30cdb27e9b95e49115cd9baad5ddbd1a6207aaa82a9", size = 160535, upload-time = "2025-10-14T04:41:06.938Z" }, + { url = "https://files.pythonhosted.org/packages/2a/e5/6a4ce77ed243c4a50a1fecca6aaaab419628c818a49434be428fe24c9957/charset_normalizer-3.4.4-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:780236ac706e66881f3b7f2f32dfe90507a09e67d1d454c762cf642e6e1586e0", size = 154816, upload-time = "2025-10-14T04:41:08.101Z" }, + { url = "https://files.pythonhosted.org/packages/a8/ef/89297262b8092b312d29cdb2517cb1237e51db8ecef2e9af5edbe7b683b1/charset_normalizer-3.4.4-cp312-cp312-win32.whl", hash = "sha256:5833d2c39d8896e4e19b689ffc198f08ea58116bee26dea51e362ecc7cd3ed26", size = 99694, upload-time = "2025-10-14T04:41:09.23Z" }, + { url = "https://files.pythonhosted.org/packages/3d/2d/1e5ed9dd3b3803994c155cd9aacb60c82c331bad84daf75bcb9c91b3295e/charset_normalizer-3.4.4-cp312-cp312-win_amd64.whl", hash = "sha256:a79cfe37875f822425b89a82333404539ae63dbdddf97f84dcbc3d339aae9525", size = 107131, upload-time = "2025-10-14T04:41:10.467Z" }, + { url = "https://files.pythonhosted.org/packages/d0/d9/0ed4c7098a861482a7b6a95603edce4c0d9db2311af23da1fb2b75ec26fc/charset_normalizer-3.4.4-cp312-cp312-win_arm64.whl", hash = "sha256:376bec83a63b8021bb5c8ea75e21c4ccb86e7e45ca4eb81146091b56599b80c3", size = 100390, upload-time = "2025-10-14T04:41:11.915Z" }, + { url = "https://files.pythonhosted.org/packages/97/45/4b3a1239bbacd321068ea6e7ac28875b03ab8bc0aa0966452db17cd36714/charset_normalizer-3.4.4-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:e1f185f86a6f3403aa2420e815904c67b2f9ebc443f045edd0de921108345794", size = 208091, upload-time = "2025-10-14T04:41:13.346Z" }, + { url = "https://files.pythonhosted.org/packages/7d/62/73a6d7450829655a35bb88a88fca7d736f9882a27eacdca2c6d505b57e2e/charset_normalizer-3.4.4-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6b39f987ae8ccdf0d2642338faf2abb1862340facc796048b604ef14919e55ed", size = 147936, upload-time = "2025-10-14T04:41:14.461Z" }, + { url = "https://files.pythonhosted.org/packages/89/c5/adb8c8b3d6625bef6d88b251bbb0d95f8205831b987631ab0c8bb5d937c2/charset_normalizer-3.4.4-cp313-cp313-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:3162d5d8ce1bb98dd51af660f2121c55d0fa541b46dff7bb9b9f86ea1d87de72", size = 144180, upload-time = "2025-10-14T04:41:15.588Z" }, + { url = "https://files.pythonhosted.org/packages/91/ed/9706e4070682d1cc219050b6048bfd293ccf67b3d4f5a4f39207453d4b99/charset_normalizer-3.4.4-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:81d5eb2a312700f4ecaa977a8235b634ce853200e828fbadf3a9c50bab278328", size = 161346, upload-time = "2025-10-14T04:41:16.738Z" }, + { url = "https://files.pythonhosted.org/packages/d5/0d/031f0d95e4972901a2f6f09ef055751805ff541511dc1252ba3ca1f80cf5/charset_normalizer-3.4.4-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:5bd2293095d766545ec1a8f612559f6b40abc0eb18bb2f5d1171872d34036ede", size = 158874, upload-time = "2025-10-14T04:41:17.923Z" }, + { url = "https://files.pythonhosted.org/packages/f5/83/6ab5883f57c9c801ce5e5677242328aa45592be8a00644310a008d04f922/charset_normalizer-3.4.4-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:a8a8b89589086a25749f471e6a900d3f662d1d3b6e2e59dcecf787b1cc3a1894", size = 153076, upload-time = "2025-10-14T04:41:19.106Z" }, + { url = "https://files.pythonhosted.org/packages/75/1e/5ff781ddf5260e387d6419959ee89ef13878229732732ee73cdae01800f2/charset_normalizer-3.4.4-cp313-cp313-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:bc7637e2f80d8530ee4a78e878bce464f70087ce73cf7c1caf142416923b98f1", size = 150601, upload-time = "2025-10-14T04:41:20.245Z" }, + { url = "https://files.pythonhosted.org/packages/d7/57/71be810965493d3510a6ca79b90c19e48696fb1ff964da319334b12677f0/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:f8bf04158c6b607d747e93949aa60618b61312fe647a6369f88ce2ff16043490", size = 150376, upload-time = "2025-10-14T04:41:21.398Z" }, + { url = "https://files.pythonhosted.org/packages/e5/d5/c3d057a78c181d007014feb7e9f2e65905a6c4ef182c0ddf0de2924edd65/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:554af85e960429cf30784dd47447d5125aaa3b99a6f0683589dbd27e2f45da44", size = 144825, upload-time = "2025-10-14T04:41:22.583Z" }, + { url = "https://files.pythonhosted.org/packages/e6/8c/d0406294828d4976f275ffbe66f00266c4b3136b7506941d87c00cab5272/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:74018750915ee7ad843a774364e13a3db91682f26142baddf775342c3f5b1133", size = 162583, upload-time = "2025-10-14T04:41:23.754Z" }, + { url = "https://files.pythonhosted.org/packages/d7/24/e2aa1f18c8f15c4c0e932d9287b8609dd30ad56dbe41d926bd846e22fb8d/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:c0463276121fdee9c49b98908b3a89c39be45d86d1dbaa22957e38f6321d4ce3", size = 150366, upload-time = "2025-10-14T04:41:25.27Z" }, + { url = "https://files.pythonhosted.org/packages/e4/5b/1e6160c7739aad1e2df054300cc618b06bf784a7a164b0f238360721ab86/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:362d61fd13843997c1c446760ef36f240cf81d3ebf74ac62652aebaf7838561e", size = 160300, upload-time = "2025-10-14T04:41:26.725Z" }, + { url = "https://files.pythonhosted.org/packages/7a/10/f882167cd207fbdd743e55534d5d9620e095089d176d55cb22d5322f2afd/charset_normalizer-3.4.4-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:9a26f18905b8dd5d685d6d07b0cdf98a79f3c7a918906af7cc143ea2e164c8bc", size = 154465, upload-time = "2025-10-14T04:41:28.322Z" }, + { url = "https://files.pythonhosted.org/packages/89/66/c7a9e1b7429be72123441bfdbaf2bc13faab3f90b933f664db506dea5915/charset_normalizer-3.4.4-cp313-cp313-win32.whl", hash = "sha256:9b35f4c90079ff2e2edc5b26c0c77925e5d2d255c42c74fdb70fb49b172726ac", size = 99404, upload-time = "2025-10-14T04:41:29.95Z" }, + { url = "https://files.pythonhosted.org/packages/c4/26/b9924fa27db384bdcd97ab83b4f0a8058d96ad9626ead570674d5e737d90/charset_normalizer-3.4.4-cp313-cp313-win_amd64.whl", hash = "sha256:b435cba5f4f750aa6c0a0d92c541fb79f69a387c91e61f1795227e4ed9cece14", size = 107092, upload-time = "2025-10-14T04:41:31.188Z" }, + { url = "https://files.pythonhosted.org/packages/af/8f/3ed4bfa0c0c72a7ca17f0380cd9e4dd842b09f664e780c13cff1dcf2ef1b/charset_normalizer-3.4.4-cp313-cp313-win_arm64.whl", hash = "sha256:542d2cee80be6f80247095cc36c418f7bddd14f4a6de45af91dfad36d817bba2", size = 100408, upload-time = "2025-10-14T04:41:32.624Z" }, + { url = "https://files.pythonhosted.org/packages/2a/35/7051599bd493e62411d6ede36fd5af83a38f37c4767b92884df7301db25d/charset_normalizer-3.4.4-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:da3326d9e65ef63a817ecbcc0df6e94463713b754fe293eaa03da99befb9a5bd", size = 207746, upload-time = "2025-10-14T04:41:33.773Z" }, + { url = "https://files.pythonhosted.org/packages/10/9a/97c8d48ef10d6cd4fcead2415523221624bf58bcf68a802721a6bc807c8f/charset_normalizer-3.4.4-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:8af65f14dc14a79b924524b1e7fffe304517b2bff5a58bf64f30b98bbc5079eb", size = 147889, upload-time = "2025-10-14T04:41:34.897Z" }, + { url = "https://files.pythonhosted.org/packages/10/bf/979224a919a1b606c82bd2c5fa49b5c6d5727aa47b4312bb27b1734f53cd/charset_normalizer-3.4.4-cp314-cp314-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:74664978bb272435107de04e36db5a9735e78232b85b77d45cfb38f758efd33e", size = 143641, upload-time = "2025-10-14T04:41:36.116Z" }, + { url = "https://files.pythonhosted.org/packages/ba/33/0ad65587441fc730dc7bd90e9716b30b4702dc7b617e6ba4997dc8651495/charset_normalizer-3.4.4-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:752944c7ffbfdd10c074dc58ec2d5a8a4cd9493b314d367c14d24c17684ddd14", size = 160779, upload-time = "2025-10-14T04:41:37.229Z" }, + { url = "https://files.pythonhosted.org/packages/67/ed/331d6b249259ee71ddea93f6f2f0a56cfebd46938bde6fcc6f7b9a3d0e09/charset_normalizer-3.4.4-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:d1f13550535ad8cff21b8d757a3257963e951d96e20ec82ab44bc64aeb62a191", size = 159035, upload-time = "2025-10-14T04:41:38.368Z" }, + { url = "https://files.pythonhosted.org/packages/67/ff/f6b948ca32e4f2a4576aa129d8bed61f2e0543bf9f5f2b7fc3758ed005c9/charset_normalizer-3.4.4-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ecaae4149d99b1c9e7b88bb03e3221956f68fd6d50be2ef061b2381b61d20838", size = 152542, upload-time = "2025-10-14T04:41:39.862Z" }, + { url = "https://files.pythonhosted.org/packages/16/85/276033dcbcc369eb176594de22728541a925b2632f9716428c851b149e83/charset_normalizer-3.4.4-cp314-cp314-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:cb6254dc36b47a990e59e1068afacdcd02958bdcce30bb50cc1700a8b9d624a6", size = 149524, upload-time = "2025-10-14T04:41:41.319Z" }, + { url = "https://files.pythonhosted.org/packages/9e/f2/6a2a1f722b6aba37050e626530a46a68f74e63683947a8acff92569f979a/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:c8ae8a0f02f57a6e61203a31428fa1d677cbe50c93622b4149d5c0f319c1d19e", size = 150395, upload-time = "2025-10-14T04:41:42.539Z" }, + { url = "https://files.pythonhosted.org/packages/60/bb/2186cb2f2bbaea6338cad15ce23a67f9b0672929744381e28b0592676824/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:47cc91b2f4dd2833fddaedd2893006b0106129d4b94fdb6af1f4ce5a9965577c", size = 143680, upload-time = "2025-10-14T04:41:43.661Z" }, + { url = "https://files.pythonhosted.org/packages/7d/a5/bf6f13b772fbb2a90360eb620d52ed8f796f3c5caee8398c3b2eb7b1c60d/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:82004af6c302b5d3ab2cfc4cc5f29db16123b1a8417f2e25f9066f91d4411090", size = 162045, upload-time = "2025-10-14T04:41:44.821Z" }, + { url = "https://files.pythonhosted.org/packages/df/c5/d1be898bf0dc3ef9030c3825e5d3b83f2c528d207d246cbabe245966808d/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:2b7d8f6c26245217bd2ad053761201e9f9680f8ce52f0fcd8d0755aeae5b2152", size = 149687, upload-time = "2025-10-14T04:41:46.442Z" }, + { url = "https://files.pythonhosted.org/packages/a5/42/90c1f7b9341eef50c8a1cb3f098ac43b0508413f33affd762855f67a410e/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:799a7a5e4fb2d5898c60b640fd4981d6a25f1c11790935a44ce38c54e985f828", size = 160014, upload-time = "2025-10-14T04:41:47.631Z" }, + { url = "https://files.pythonhosted.org/packages/76/be/4d3ee471e8145d12795ab655ece37baed0929462a86e72372fd25859047c/charset_normalizer-3.4.4-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:99ae2cffebb06e6c22bdc25801d7b30f503cc87dbd283479e7b606f70aff57ec", size = 154044, upload-time = "2025-10-14T04:41:48.81Z" }, + { url = "https://files.pythonhosted.org/packages/b0/6f/8f7af07237c34a1defe7defc565a9bc1807762f672c0fde711a4b22bf9c0/charset_normalizer-3.4.4-cp314-cp314-win32.whl", hash = "sha256:f9d332f8c2a2fcbffe1378594431458ddbef721c1769d78e2cbc06280d8155f9", size = 99940, upload-time = "2025-10-14T04:41:49.946Z" }, + { url = "https://files.pythonhosted.org/packages/4b/51/8ade005e5ca5b0d80fb4aff72a3775b325bdc3d27408c8113811a7cbe640/charset_normalizer-3.4.4-cp314-cp314-win_amd64.whl", hash = "sha256:8a6562c3700cce886c5be75ade4a5db4214fda19fede41d9792d100288d8f94c", size = 107104, upload-time = "2025-10-14T04:41:51.051Z" }, + { url = "https://files.pythonhosted.org/packages/da/5f/6b8f83a55bb8278772c5ae54a577f3099025f9ade59d0136ac24a0df4bde/charset_normalizer-3.4.4-cp314-cp314-win_arm64.whl", hash = "sha256:de00632ca48df9daf77a2c65a484531649261ec9f25489917f09e455cb09ddb2", size = 100743, upload-time = "2025-10-14T04:41:52.122Z" }, + { url = "https://files.pythonhosted.org/packages/0a/4c/925909008ed5a988ccbb72dcc897407e5d6d3bd72410d69e051fc0c14647/charset_normalizer-3.4.4-py3-none-any.whl", hash = "sha256:7a32c560861a02ff789ad905a2fe94e3f840803362c84fecf1851cb4cf3dc37f", size = 53402, upload-time = "2025-10-14T04:42:31.76Z" }, +] + +[[package]] +name = "click" +version = "8.3.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "colorama", marker = "sys_platform == 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/3d/fa/656b739db8587d7b5dfa22e22ed02566950fbfbcdc20311993483657a5c0/click-8.3.1.tar.gz", hash = "sha256:12ff4785d337a1bb490bb7e9c2b1ee5da3112e94a8622f26a6c77f5d2fc6842a", size = 295065, upload-time = "2025-11-15T20:45:42.706Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/98/78/01c019cdb5d6498122777c1a43056ebb3ebfeef2076d9d026bfe15583b2b/click-8.3.1-py3-none-any.whl", hash = "sha256:981153a64e25f12d547d3426c367a4857371575ee7ad18df2a6183ab0545b2a6", size = 108274, upload-time = "2025-11-15T20:45:41.139Z" }, +] + +[[package]] +name = "clr-loader" +version = "0.3.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "cffi", marker = "sys_platform == 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/e4/46/7eea92b6aa2d68af78e049cbecec5f757f1aad44ecdecdc16bbad7eead51/clr_loader-0.3.1.tar.gz", hash = "sha256:2e073e9aaf49d1ae2f56ecba27987ad5fb68be4bcd9dd34a5bed8f0e4e128366", size = 86805, upload-time = "2026-04-18T17:49:44.287Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/5e/da/ec1a6e36624000b6df0dd61183c42342ee5814c073315e802cadaad04d2f/clr_loader-0.3.1-py3-none-any.whl", hash = "sha256:cbad189de20d202a7d621956b0fc38049e13c9bf7ca2923441eff725cd121aa1", size = 55730, upload-time = "2026-04-18T17:49:42.99Z" }, +] + +[[package]] +name = "colorama" +version = "0.4.6" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/d8/53/6f443c9a4a8358a93a6792e2acffb9d9d5cb0a5cfd8802644b7b1c9a02e4/colorama-0.4.6.tar.gz", hash = "sha256:08695f5cb7ed6e0531a20572697297273c47b8cae5a63ffc6d6ed5c201be6e44", size = 27697, upload-time = "2022-10-25T02:36:22.414Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d1/d6/3965ed04c63042e047cb6a3e6ed1a63a35087b6a609aa3a15ed8ac56c221/colorama-0.4.6-py2.py3-none-any.whl", hash = "sha256:4f1d9991f5acc0ca119f9d443620b77f9d6b33703e51011c16baf57afb285fc6", size = 25335, upload-time = "2022-10-25T02:36:20.889Z" }, +] + +[[package]] +name = "comm" +version = "0.2.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/4c/13/7d740c5849255756bc17888787313b61fd38a0a8304fc4f073dfc46122aa/comm-0.2.3.tar.gz", hash = "sha256:2dc8048c10962d55d7ad693be1e7045d891b7ce8d999c97963a5e3e99c055971", size = 6319, upload-time = "2025-07-25T14:02:04.452Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/60/97/891a0971e1e4a8c5d2b20bbe0e524dc04548d2307fee33cdeba148fd4fc7/comm-0.2.3-py3-none-any.whl", hash = "sha256:c615d91d75f7f04f095b30d1c1711babd43bdc6419c1be9886a85f2f4e489417", size = 7294, upload-time = "2025-07-25T14:02:02.896Z" }, +] + +[[package]] +name = "contourpy" +version = "1.3.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/58/01/1253e6698a07380cd31a736d248a3f2a50a7c88779a1813da27503cadc2a/contourpy-1.3.3.tar.gz", hash = "sha256:083e12155b210502d0bca491432bb04d56dc3432f95a979b429f2848c3dbe880", size = 13466174, upload-time = "2025-07-26T12:03:12.549Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/91/2e/c4390a31919d8a78b90e8ecf87cd4b4c4f05a5b48d05ec17db8e5404c6f4/contourpy-1.3.3-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:709a48ef9a690e1343202916450bc48b9e51c049b089c7f79a267b46cffcdaa1", size = 288773, upload-time = "2025-07-26T12:01:02.277Z" }, + { url = "https://files.pythonhosted.org/packages/0d/44/c4b0b6095fef4dc9c420e041799591e3b63e9619e3044f7f4f6c21c0ab24/contourpy-1.3.3-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:23416f38bfd74d5d28ab8429cc4d63fa67d5068bd711a85edb1c3fb0c3e2f381", size = 270149, upload-time = "2025-07-26T12:01:04.072Z" }, + { url = "https://files.pythonhosted.org/packages/30/2e/dd4ced42fefac8470661d7cb7e264808425e6c5d56d175291e93890cce09/contourpy-1.3.3-cp311-cp311-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:929ddf8c4c7f348e4c0a5a3a714b5c8542ffaa8c22954862a46ca1813b667ee7", size = 329222, upload-time = "2025-07-26T12:01:05.688Z" }, + { url = "https://files.pythonhosted.org/packages/f2/74/cc6ec2548e3d276c71389ea4802a774b7aa3558223b7bade3f25787fafc2/contourpy-1.3.3-cp311-cp311-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:9e999574eddae35f1312c2b4b717b7885d4edd6cb46700e04f7f02db454e67c1", size = 377234, upload-time = "2025-07-26T12:01:07.054Z" }, + { url = "https://files.pythonhosted.org/packages/03/b3/64ef723029f917410f75c09da54254c5f9ea90ef89b143ccadb09df14c15/contourpy-1.3.3-cp311-cp311-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:0bf67e0e3f482cb69779dd3061b534eb35ac9b17f163d851e2a547d56dba0a3a", size = 380555, upload-time = "2025-07-26T12:01:08.801Z" }, + { url = "https://files.pythonhosted.org/packages/5f/4b/6157f24ca425b89fe2eb7e7be642375711ab671135be21e6faa100f7448c/contourpy-1.3.3-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:51e79c1f7470158e838808d4a996fa9bac72c498e93d8ebe5119bc1e6becb0db", size = 355238, upload-time = "2025-07-26T12:01:10.319Z" }, + { url = "https://files.pythonhosted.org/packages/98/56/f914f0dd678480708a04cfd2206e7c382533249bc5001eb9f58aa693e200/contourpy-1.3.3-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:598c3aaece21c503615fd59c92a3598b428b2f01bfb4b8ca9c4edeecc2438620", size = 1326218, upload-time = "2025-07-26T12:01:12.659Z" }, + { url = "https://files.pythonhosted.org/packages/fb/d7/4a972334a0c971acd5172389671113ae82aa7527073980c38d5868ff1161/contourpy-1.3.3-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:322ab1c99b008dad206d406bb61d014cf0174df491ae9d9d0fac6a6fda4f977f", size = 1392867, upload-time = "2025-07-26T12:01:15.533Z" }, + { url = "https://files.pythonhosted.org/packages/75/3e/f2cc6cd56dc8cff46b1a56232eabc6feea52720083ea71ab15523daab796/contourpy-1.3.3-cp311-cp311-win32.whl", hash = "sha256:fd907ae12cd483cd83e414b12941c632a969171bf90fc937d0c9f268a31cafff", size = 183677, upload-time = "2025-07-26T12:01:17.088Z" }, + { url = "https://files.pythonhosted.org/packages/98/4b/9bd370b004b5c9d8045c6c33cf65bae018b27aca550a3f657cdc99acdbd8/contourpy-1.3.3-cp311-cp311-win_amd64.whl", hash = "sha256:3519428f6be58431c56581f1694ba8e50626f2dd550af225f82fb5f5814d2a42", size = 225234, upload-time = "2025-07-26T12:01:18.256Z" }, + { url = "https://files.pythonhosted.org/packages/d9/b6/71771e02c2e004450c12b1120a5f488cad2e4d5b590b1af8bad060360fe4/contourpy-1.3.3-cp311-cp311-win_arm64.whl", hash = "sha256:15ff10bfada4bf92ec8b31c62bf7c1834c244019b4a33095a68000d7075df470", size = 193123, upload-time = "2025-07-26T12:01:19.848Z" }, + { url = "https://files.pythonhosted.org/packages/be/45/adfee365d9ea3d853550b2e735f9d66366701c65db7855cd07621732ccfc/contourpy-1.3.3-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:b08a32ea2f8e42cf1d4be3169a98dd4be32bafe4f22b6c4cb4ba810fa9e5d2cb", size = 293419, upload-time = "2025-07-26T12:01:21.16Z" }, + { url = "https://files.pythonhosted.org/packages/53/3e/405b59cfa13021a56bba395a6b3aca8cec012b45bf177b0eaf7a202cde2c/contourpy-1.3.3-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:556dba8fb6f5d8742f2923fe9457dbdd51e1049c4a43fd3986a0b14a1d815fc6", size = 273979, upload-time = "2025-07-26T12:01:22.448Z" }, + { url = "https://files.pythonhosted.org/packages/d4/1c/a12359b9b2ca3a845e8f7f9ac08bdf776114eb931392fcad91743e2ea17b/contourpy-1.3.3-cp312-cp312-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:92d9abc807cf7d0e047b95ca5d957cf4792fcd04e920ca70d48add15c1a90ea7", size = 332653, upload-time = "2025-07-26T12:01:24.155Z" }, + { url = "https://files.pythonhosted.org/packages/63/12/897aeebfb475b7748ea67b61e045accdfcf0d971f8a588b67108ed7f5512/contourpy-1.3.3-cp312-cp312-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:b2e8faa0ed68cb29af51edd8e24798bb661eac3bd9f65420c1887b6ca89987c8", size = 379536, upload-time = "2025-07-26T12:01:25.91Z" }, + { url = "https://files.pythonhosted.org/packages/43/8a/a8c584b82deb248930ce069e71576fc09bd7174bbd35183b7943fb1064fd/contourpy-1.3.3-cp312-cp312-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:626d60935cf668e70a5ce6ff184fd713e9683fb458898e4249b63be9e28286ea", size = 384397, upload-time = "2025-07-26T12:01:27.152Z" }, + { url = "https://files.pythonhosted.org/packages/cc/8f/ec6289987824b29529d0dfda0d74a07cec60e54b9c92f3c9da4c0ac732de/contourpy-1.3.3-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:4d00e655fcef08aba35ec9610536bfe90267d7ab5ba944f7032549c55a146da1", size = 362601, upload-time = "2025-07-26T12:01:28.808Z" }, + { url = "https://files.pythonhosted.org/packages/05/0a/a3fe3be3ee2dceb3e615ebb4df97ae6f3828aa915d3e10549ce016302bd1/contourpy-1.3.3-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:451e71b5a7d597379ef572de31eeb909a87246974d960049a9848c3bc6c41bf7", size = 1331288, upload-time = "2025-07-26T12:01:31.198Z" }, + { url = "https://files.pythonhosted.org/packages/33/1d/acad9bd4e97f13f3e2b18a3977fe1b4a37ecf3d38d815333980c6c72e963/contourpy-1.3.3-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:459c1f020cd59fcfe6650180678a9993932d80d44ccde1fa1868977438f0b411", size = 1403386, upload-time = "2025-07-26T12:01:33.947Z" }, + { url = "https://files.pythonhosted.org/packages/cf/8f/5847f44a7fddf859704217a99a23a4f6417b10e5ab1256a179264561540e/contourpy-1.3.3-cp312-cp312-win32.whl", hash = "sha256:023b44101dfe49d7d53932be418477dba359649246075c996866106da069af69", size = 185018, upload-time = "2025-07-26T12:01:35.64Z" }, + { url = "https://files.pythonhosted.org/packages/19/e8/6026ed58a64563186a9ee3f29f41261fd1828f527dd93d33b60feca63352/contourpy-1.3.3-cp312-cp312-win_amd64.whl", hash = "sha256:8153b8bfc11e1e4d75bcb0bff1db232f9e10b274e0929de9d608027e0d34ff8b", size = 226567, upload-time = "2025-07-26T12:01:36.804Z" }, + { url = "https://files.pythonhosted.org/packages/d1/e2/f05240d2c39a1ed228d8328a78b6f44cd695f7ef47beb3e684cf93604f86/contourpy-1.3.3-cp312-cp312-win_arm64.whl", hash = "sha256:07ce5ed73ecdc4a03ffe3e1b3e3c1166db35ae7584be76f65dbbe28a7791b0cc", size = 193655, upload-time = "2025-07-26T12:01:37.999Z" }, + { url = "https://files.pythonhosted.org/packages/68/35/0167aad910bbdb9599272bd96d01a9ec6852f36b9455cf2ca67bd4cc2d23/contourpy-1.3.3-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:177fb367556747a686509d6fef71d221a4b198a3905fe824430e5ea0fda54eb5", size = 293257, upload-time = "2025-07-26T12:01:39.367Z" }, + { url = "https://files.pythonhosted.org/packages/96/e4/7adcd9c8362745b2210728f209bfbcf7d91ba868a2c5f40d8b58f54c509b/contourpy-1.3.3-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:d002b6f00d73d69333dac9d0b8d5e84d9724ff9ef044fd63c5986e62b7c9e1b1", size = 274034, upload-time = "2025-07-26T12:01:40.645Z" }, + { url = "https://files.pythonhosted.org/packages/73/23/90e31ceeed1de63058a02cb04b12f2de4b40e3bef5e082a7c18d9c8ae281/contourpy-1.3.3-cp313-cp313-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:348ac1f5d4f1d66d3322420f01d42e43122f43616e0f194fc1c9f5d830c5b286", size = 334672, upload-time = "2025-07-26T12:01:41.942Z" }, + { url = "https://files.pythonhosted.org/packages/ed/93/b43d8acbe67392e659e1d984700e79eb67e2acb2bd7f62012b583a7f1b55/contourpy-1.3.3-cp313-cp313-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:655456777ff65c2c548b7c454af9c6f33f16c8884f11083244b5819cc214f1b5", size = 381234, upload-time = "2025-07-26T12:01:43.499Z" }, + { url = "https://files.pythonhosted.org/packages/46/3b/bec82a3ea06f66711520f75a40c8fc0b113b2a75edb36aa633eb11c4f50f/contourpy-1.3.3-cp313-cp313-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:644a6853d15b2512d67881586bd03f462c7ab755db95f16f14d7e238f2852c67", size = 385169, upload-time = "2025-07-26T12:01:45.219Z" }, + { url = "https://files.pythonhosted.org/packages/4b/32/e0f13a1c5b0f8572d0ec6ae2f6c677b7991fafd95da523159c19eff0696a/contourpy-1.3.3-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:4debd64f124ca62069f313a9cb86656ff087786016d76927ae2cf37846b006c9", size = 362859, upload-time = "2025-07-26T12:01:46.519Z" }, + { url = "https://files.pythonhosted.org/packages/33/71/e2a7945b7de4e58af42d708a219f3b2f4cff7386e6b6ab0a0fa0033c49a9/contourpy-1.3.3-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:a15459b0f4615b00bbd1e91f1b9e19b7e63aea7483d03d804186f278c0af2659", size = 1332062, upload-time = "2025-07-26T12:01:48.964Z" }, + { url = "https://files.pythonhosted.org/packages/12/fc/4e87ac754220ccc0e807284f88e943d6d43b43843614f0a8afa469801db0/contourpy-1.3.3-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:ca0fdcd73925568ca027e0b17ab07aad764be4706d0a925b89227e447d9737b7", size = 1403932, upload-time = "2025-07-26T12:01:51.979Z" }, + { url = "https://files.pythonhosted.org/packages/a6/2e/adc197a37443f934594112222ac1aa7dc9a98faf9c3842884df9a9d8751d/contourpy-1.3.3-cp313-cp313-win32.whl", hash = "sha256:b20c7c9a3bf701366556e1b1984ed2d0cedf999903c51311417cf5f591d8c78d", size = 185024, upload-time = "2025-07-26T12:01:53.245Z" }, + { url = "https://files.pythonhosted.org/packages/18/0b/0098c214843213759692cc638fce7de5c289200a830e5035d1791d7a2338/contourpy-1.3.3-cp313-cp313-win_amd64.whl", hash = "sha256:1cadd8b8969f060ba45ed7c1b714fe69185812ab43bd6b86a9123fe8f99c3263", size = 226578, upload-time = "2025-07-26T12:01:54.422Z" }, + { url = "https://files.pythonhosted.org/packages/8a/9a/2f6024a0c5995243cd63afdeb3651c984f0d2bc727fd98066d40e141ad73/contourpy-1.3.3-cp313-cp313-win_arm64.whl", hash = "sha256:fd914713266421b7536de2bfa8181aa8c699432b6763a0ea64195ebe28bff6a9", size = 193524, upload-time = "2025-07-26T12:01:55.73Z" }, + { url = "https://files.pythonhosted.org/packages/c0/b3/f8a1a86bd3298513f500e5b1f5fd92b69896449f6cab6a146a5d52715479/contourpy-1.3.3-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:88df9880d507169449d434c293467418b9f6cbe82edd19284aa0409e7fdb933d", size = 306730, upload-time = "2025-07-26T12:01:57.051Z" }, + { url = "https://files.pythonhosted.org/packages/3f/11/4780db94ae62fc0c2053909b65dc3246bd7cecfc4f8a20d957ad43aa4ad8/contourpy-1.3.3-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:d06bb1f751ba5d417047db62bca3c8fde202b8c11fb50742ab3ab962c81e8216", size = 287897, upload-time = "2025-07-26T12:01:58.663Z" }, + { url = "https://files.pythonhosted.org/packages/ae/15/e59f5f3ffdd6f3d4daa3e47114c53daabcb18574a26c21f03dc9e4e42ff0/contourpy-1.3.3-cp313-cp313t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e4e6b05a45525357e382909a4c1600444e2a45b4795163d3b22669285591c1ae", size = 326751, upload-time = "2025-07-26T12:02:00.343Z" }, + { url = "https://files.pythonhosted.org/packages/0f/81/03b45cfad088e4770b1dcf72ea78d3802d04200009fb364d18a493857210/contourpy-1.3.3-cp313-cp313t-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:ab3074b48c4e2cf1a960e6bbeb7f04566bf36b1861d5c9d4d8ac04b82e38ba20", size = 375486, upload-time = "2025-07-26T12:02:02.128Z" }, + { url = "https://files.pythonhosted.org/packages/0c/ba/49923366492ffbdd4486e970d421b289a670ae8cf539c1ea9a09822b371a/contourpy-1.3.3-cp313-cp313t-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:6c3d53c796f8647d6deb1abe867daeb66dcc8a97e8455efa729516b997b8ed99", size = 388106, upload-time = "2025-07-26T12:02:03.615Z" }, + { url = "https://files.pythonhosted.org/packages/9f/52/5b00ea89525f8f143651f9f03a0df371d3cbd2fccd21ca9b768c7a6500c2/contourpy-1.3.3-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:50ed930df7289ff2a8d7afeb9603f8289e5704755c7e5c3bbd929c90c817164b", size = 352548, upload-time = "2025-07-26T12:02:05.165Z" }, + { url = "https://files.pythonhosted.org/packages/32/1d/a209ec1a3a3452d490f6b14dd92e72280c99ae3d1e73da74f8277d4ee08f/contourpy-1.3.3-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:4feffb6537d64b84877da813a5c30f1422ea5739566abf0bd18065ac040e120a", size = 1322297, upload-time = "2025-07-26T12:02:07.379Z" }, + { url = "https://files.pythonhosted.org/packages/bc/9e/46f0e8ebdd884ca0e8877e46a3f4e633f6c9c8c4f3f6e72be3fe075994aa/contourpy-1.3.3-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:2b7e9480ffe2b0cd2e787e4df64270e3a0440d9db8dc823312e2c940c167df7e", size = 1391023, upload-time = "2025-07-26T12:02:10.171Z" }, + { url = "https://files.pythonhosted.org/packages/b9/70/f308384a3ae9cd2209e0849f33c913f658d3326900d0ff5d378d6a1422d2/contourpy-1.3.3-cp313-cp313t-win32.whl", hash = "sha256:283edd842a01e3dcd435b1c5116798d661378d83d36d337b8dde1d16a5fc9ba3", size = 196157, upload-time = "2025-07-26T12:02:11.488Z" }, + { url = "https://files.pythonhosted.org/packages/b2/dd/880f890a6663b84d9e34a6f88cded89d78f0091e0045a284427cb6b18521/contourpy-1.3.3-cp313-cp313t-win_amd64.whl", hash = "sha256:87acf5963fc2b34825e5b6b048f40e3635dd547f590b04d2ab317c2619ef7ae8", size = 240570, upload-time = "2025-07-26T12:02:12.754Z" }, + { url = "https://files.pythonhosted.org/packages/80/99/2adc7d8ffead633234817ef8e9a87115c8a11927a94478f6bb3d3f4d4f7d/contourpy-1.3.3-cp313-cp313t-win_arm64.whl", hash = "sha256:3c30273eb2a55024ff31ba7d052dde990d7d8e5450f4bbb6e913558b3d6c2301", size = 199713, upload-time = "2025-07-26T12:02:14.4Z" }, + { url = "https://files.pythonhosted.org/packages/72/8b/4546f3ab60f78c514ffb7d01a0bd743f90de36f0019d1be84d0a708a580a/contourpy-1.3.3-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:fde6c716d51c04b1c25d0b90364d0be954624a0ee9d60e23e850e8d48353d07a", size = 292189, upload-time = "2025-07-26T12:02:16.095Z" }, + { url = "https://files.pythonhosted.org/packages/fd/e1/3542a9cb596cadd76fcef413f19c79216e002623158befe6daa03dbfa88c/contourpy-1.3.3-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:cbedb772ed74ff5be440fa8eee9bd49f64f6e3fc09436d9c7d8f1c287b121d77", size = 273251, upload-time = "2025-07-26T12:02:17.524Z" }, + { url = "https://files.pythonhosted.org/packages/b1/71/f93e1e9471d189f79d0ce2497007731c1e6bf9ef6d1d61b911430c3db4e5/contourpy-1.3.3-cp314-cp314-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:22e9b1bd7a9b1d652cd77388465dc358dafcd2e217d35552424aa4f996f524f5", size = 335810, upload-time = "2025-07-26T12:02:18.9Z" }, + { url = "https://files.pythonhosted.org/packages/91/f9/e35f4c1c93f9275d4e38681a80506b5510e9327350c51f8d4a5a724d178c/contourpy-1.3.3-cp314-cp314-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:a22738912262aa3e254e4f3cb079a95a67132fc5a063890e224393596902f5a4", size = 382871, upload-time = "2025-07-26T12:02:20.418Z" }, + { url = "https://files.pythonhosted.org/packages/b5/71/47b512f936f66a0a900d81c396a7e60d73419868fba959c61efed7a8ab46/contourpy-1.3.3-cp314-cp314-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:afe5a512f31ee6bd7d0dda52ec9864c984ca3d66664444f2d72e0dc4eb832e36", size = 386264, upload-time = "2025-07-26T12:02:21.916Z" }, + { url = "https://files.pythonhosted.org/packages/04/5f/9ff93450ba96b09c7c2b3f81c94de31c89f92292f1380261bd7195bea4ea/contourpy-1.3.3-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:f64836de09927cba6f79dcd00fdd7d5329f3fccc633468507079c829ca4db4e3", size = 363819, upload-time = "2025-07-26T12:02:23.759Z" }, + { url = "https://files.pythonhosted.org/packages/3e/a6/0b185d4cc480ee494945cde102cb0149ae830b5fa17bf855b95f2e70ad13/contourpy-1.3.3-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:1fd43c3be4c8e5fd6e4f2baeae35ae18176cf2e5cced681cca908addf1cdd53b", size = 1333650, upload-time = "2025-07-26T12:02:26.181Z" }, + { url = "https://files.pythonhosted.org/packages/43/d7/afdc95580ca56f30fbcd3060250f66cedbde69b4547028863abd8aa3b47e/contourpy-1.3.3-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:6afc576f7b33cf00996e5c1102dc2a8f7cc89e39c0b55df93a0b78c1bd992b36", size = 1404833, upload-time = "2025-07-26T12:02:28.782Z" }, + { url = "https://files.pythonhosted.org/packages/e2/e2/366af18a6d386f41132a48f033cbd2102e9b0cf6345d35ff0826cd984566/contourpy-1.3.3-cp314-cp314-win32.whl", hash = "sha256:66c8a43a4f7b8df8b71ee1840e4211a3c8d93b214b213f590e18a1beca458f7d", size = 189692, upload-time = "2025-07-26T12:02:30.128Z" }, + { url = "https://files.pythonhosted.org/packages/7d/c2/57f54b03d0f22d4044b8afb9ca0e184f8b1afd57b4f735c2fa70883dc601/contourpy-1.3.3-cp314-cp314-win_amd64.whl", hash = "sha256:cf9022ef053f2694e31d630feaacb21ea24224be1c3ad0520b13d844274614fd", size = 232424, upload-time = "2025-07-26T12:02:31.395Z" }, + { url = "https://files.pythonhosted.org/packages/18/79/a9416650df9b525737ab521aa181ccc42d56016d2123ddcb7b58e926a42c/contourpy-1.3.3-cp314-cp314-win_arm64.whl", hash = "sha256:95b181891b4c71de4bb404c6621e7e2390745f887f2a026b2d99e92c17892339", size = 198300, upload-time = "2025-07-26T12:02:32.956Z" }, + { url = "https://files.pythonhosted.org/packages/1f/42/38c159a7d0f2b7b9c04c64ab317042bb6952b713ba875c1681529a2932fe/contourpy-1.3.3-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:33c82d0138c0a062380332c861387650c82e4cf1747aaa6938b9b6516762e772", size = 306769, upload-time = "2025-07-26T12:02:34.2Z" }, + { url = "https://files.pythonhosted.org/packages/c3/6c/26a8205f24bca10974e77460de68d3d7c63e282e23782f1239f226fcae6f/contourpy-1.3.3-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:ea37e7b45949df430fe649e5de8351c423430046a2af20b1c1961cae3afcda77", size = 287892, upload-time = "2025-07-26T12:02:35.807Z" }, + { url = "https://files.pythonhosted.org/packages/66/06/8a475c8ab718ebfd7925661747dbb3c3ee9c82ac834ccb3570be49d129f4/contourpy-1.3.3-cp314-cp314t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d304906ecc71672e9c89e87c4675dc5c2645e1f4269a5063b99b0bb29f232d13", size = 326748, upload-time = "2025-07-26T12:02:37.193Z" }, + { url = "https://files.pythonhosted.org/packages/b4/a3/c5ca9f010a44c223f098fccd8b158bb1cb287378a31ac141f04730dc49be/contourpy-1.3.3-cp314-cp314t-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:ca658cd1a680a5c9ea96dc61cdbae1e85c8f25849843aa799dfd3cb370ad4fbe", size = 375554, upload-time = "2025-07-26T12:02:38.894Z" }, + { url = "https://files.pythonhosted.org/packages/80/5b/68bd33ae63fac658a4145088c1e894405e07584a316738710b636c6d0333/contourpy-1.3.3-cp314-cp314t-manylinux_2_26_s390x.manylinux_2_28_s390x.whl", hash = "sha256:ab2fd90904c503739a75b7c8c5c01160130ba67944a7b77bbf36ef8054576e7f", size = 388118, upload-time = "2025-07-26T12:02:40.642Z" }, + { url = "https://files.pythonhosted.org/packages/40/52/4c285a6435940ae25d7410a6c36bda5145839bc3f0beb20c707cda18b9d2/contourpy-1.3.3-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b7301b89040075c30e5768810bc96a8e8d78085b47d8be6e4c3f5a0b4ed478a0", size = 352555, upload-time = "2025-07-26T12:02:42.25Z" }, + { url = "https://files.pythonhosted.org/packages/24/ee/3e81e1dd174f5c7fefe50e85d0892de05ca4e26ef1c9a59c2a57e43b865a/contourpy-1.3.3-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:2a2a8b627d5cc6b7c41a4beff6c5ad5eb848c88255fda4a8745f7e901b32d8e4", size = 1322295, upload-time = "2025-07-26T12:02:44.668Z" }, + { url = "https://files.pythonhosted.org/packages/3c/b2/6d913d4d04e14379de429057cd169e5e00f6c2af3bb13e1710bcbdb5da12/contourpy-1.3.3-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:fd6ec6be509c787f1caf6b247f0b1ca598bef13f4ddeaa126b7658215529ba0f", size = 1391027, upload-time = "2025-07-26T12:02:47.09Z" }, + { url = "https://files.pythonhosted.org/packages/93/8a/68a4ec5c55a2971213d29a9374913f7e9f18581945a7a31d1a39b5d2dfe5/contourpy-1.3.3-cp314-cp314t-win32.whl", hash = "sha256:e74a9a0f5e3fff48fb5a7f2fd2b9b70a3fe014a67522f79b7cca4c0c7e43c9ae", size = 202428, upload-time = "2025-07-26T12:02:48.691Z" }, + { url = "https://files.pythonhosted.org/packages/fa/96/fd9f641ffedc4fa3ace923af73b9d07e869496c9cc7a459103e6e978992f/contourpy-1.3.3-cp314-cp314t-win_amd64.whl", hash = "sha256:13b68d6a62db8eafaebb8039218921399baf6e47bf85006fd8529f2a08ef33fc", size = 250331, upload-time = "2025-07-26T12:02:50.137Z" }, + { url = "https://files.pythonhosted.org/packages/ae/8c/469afb6465b853afff216f9528ffda78a915ff880ed58813ba4faf4ba0b6/contourpy-1.3.3-cp314-cp314t-win_arm64.whl", hash = "sha256:b7448cb5a725bb1e35ce88771b86fba35ef418952474492cf7c764059933ff8b", size = 203831, upload-time = "2025-07-26T12:02:51.449Z" }, + { url = "https://files.pythonhosted.org/packages/a5/29/8dcfe16f0107943fa92388c23f6e05cff0ba58058c4c95b00280d4c75a14/contourpy-1.3.3-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:cd5dfcaeb10f7b7f9dc8941717c6c2ade08f587be2226222c12b25f0483ed497", size = 278809, upload-time = "2025-07-26T12:02:52.74Z" }, + { url = "https://files.pythonhosted.org/packages/85/a9/8b37ef4f7dafeb335daee3c8254645ef5725be4d9c6aa70b50ec46ef2f7e/contourpy-1.3.3-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:0c1fc238306b35f246d61a1d416a627348b5cf0648648a031e14bb8705fcdfe8", size = 261593, upload-time = "2025-07-26T12:02:54.037Z" }, + { url = "https://files.pythonhosted.org/packages/0a/59/ebfb8c677c75605cc27f7122c90313fd2f375ff3c8d19a1694bda74aaa63/contourpy-1.3.3-pp311-pypy311_pp73-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:70f9aad7de812d6541d29d2bbf8feb22ff7e1c299523db288004e3157ff4674e", size = 302202, upload-time = "2025-07-26T12:02:55.947Z" }, + { url = "https://files.pythonhosted.org/packages/3c/37/21972a15834d90bfbfb009b9d004779bd5a07a0ec0234e5ba8f64d5736f4/contourpy-1.3.3-pp311-pypy311_pp73-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:5ed3657edf08512fc3fe81b510e35c2012fbd3081d2e26160f27ca28affec989", size = 329207, upload-time = "2025-07-26T12:02:57.468Z" }, + { url = "https://files.pythonhosted.org/packages/0c/58/bd257695f39d05594ca4ad60df5bcb7e32247f9951fd09a9b8edb82d1daa/contourpy-1.3.3-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:3d1a3799d62d45c18bafd41c5fa05120b96a28079f2393af559b843d1a966a77", size = 225315, upload-time = "2025-07-26T12:02:58.801Z" }, +] + +[[package]] +name = "cuda-bindings" +version = "12.9.4" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "cuda-pathfinder", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/45/e7/b47792cc2d01c7e1d37c32402182524774dadd2d26339bd224e0e913832e/cuda_bindings-12.9.4-cp311-cp311-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:c912a3d9e6b6651853eed8eed96d6800d69c08e94052c292fec3f282c5a817c9", size = 12210593, upload-time = "2025-10-21T14:51:36.574Z" }, + { url = "https://files.pythonhosted.org/packages/a9/c1/dabe88f52c3e3760d861401bb994df08f672ec893b8f7592dc91626adcf3/cuda_bindings-12.9.4-cp312-cp312-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:fda147a344e8eaeca0c6ff113d2851ffca8f7dfc0a6c932374ee5c47caa649c8", size = 12151019, upload-time = "2025-10-21T14:51:43.167Z" }, + { url = "https://files.pythonhosted.org/packages/63/56/e465c31dc9111be3441a9ba7df1941fe98f4aa6e71e8788a3fb4534ce24d/cuda_bindings-12.9.4-cp313-cp313-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:32bdc5a76906be4c61eb98f546a6786c5773a881f3b166486449b5d141e4a39f", size = 11906628, upload-time = "2025-10-21T14:51:49.905Z" }, + { url = "https://files.pythonhosted.org/packages/a3/84/1e6be415e37478070aeeee5884c2022713c1ecc735e6d82d744de0252eee/cuda_bindings-12.9.4-cp313-cp313t-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:56e0043c457a99ac473ddc926fe0dc4046694d99caef633e92601ab52cbe17eb", size = 11925991, upload-time = "2025-10-21T14:51:56.535Z" }, + { url = "https://files.pythonhosted.org/packages/d1/af/6dfd8f2ed90b1d4719bc053ff8940e494640fe4212dc3dd72f383e4992da/cuda_bindings-12.9.4-cp314-cp314-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8b72ee72a9cc1b531db31eebaaee5c69a8ec3500e32c6933f2d3b15297b53686", size = 11922703, upload-time = "2025-10-21T14:52:03.585Z" }, + { url = "https://files.pythonhosted.org/packages/6c/19/90ac264acc00f6df8a49378eedec9fd2db3061bf9263bf9f39fd3d8377c3/cuda_bindings-12.9.4-cp314-cp314t-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:d80bffc357df9988dca279734bc9674c3934a654cab10cadeed27ce17d8635ee", size = 11924658, upload-time = "2025-10-21T14:52:10.411Z" }, +] + +[[package]] +name = "cuda-pathfinder" +version = "1.3.4" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b8/5e/db279a3bfbd18d59d0598922a3b3c1454908d0969e8372260afec9736376/cuda_pathfinder-1.3.4-py3-none-any.whl", hash = "sha256:fb983f6e0d43af27ef486e14d5989b5f904ef45cedf40538bfdcbffa6bb01fb2", size = 30878, upload-time = "2026-02-11T18:50:31.008Z" }, +] + +[[package]] +name = "cycler" +version = "0.12.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/a9/95/a3dbbb5028f35eafb79008e7522a75244477d2838f38cbb722248dabc2a8/cycler-0.12.1.tar.gz", hash = "sha256:88bb128f02ba341da8ef447245a9e138fae777f6a23943da4540077d3601eb1c", size = 7615, upload-time = "2023-10-07T05:32:18.335Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e7/05/c19819d5e3d95294a6f5947fb9b9629efb316b96de511b418c53d245aae6/cycler-0.12.1-py3-none-any.whl", hash = "sha256:85cef7cff222d8644161529808465972e51340599459b8ac3ccbac5a854e0d30", size = 8321, upload-time = "2023-10-07T05:32:16.783Z" }, +] + +[[package]] +name = "debugpy" +version = "1.8.20" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/e0/b7/cd8080344452e4874aae67c40d8940e2b4d47b01601a8fd9f44786c757c7/debugpy-1.8.20.tar.gz", hash = "sha256:55bc8701714969f1ab89a6d5f2f3d40c36f91b2cbe2f65d98bf8196f6a6a2c33", size = 1645207, upload-time = "2026-01-29T23:03:28.199Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/51/56/c3baf5cbe4dd77427fd9aef99fcdade259ad128feeb8a786c246adb838e5/debugpy-1.8.20-cp311-cp311-macosx_15_0_universal2.whl", hash = "sha256:eada6042ad88fa1571b74bd5402ee8b86eded7a8f7b827849761700aff171f1b", size = 2208318, upload-time = "2026-01-29T23:03:36.481Z" }, + { url = "https://files.pythonhosted.org/packages/9a/7d/4fa79a57a8e69fe0d9763e98d1110320f9ecd7f1f362572e3aafd7417c9d/debugpy-1.8.20-cp311-cp311-manylinux_2_34_x86_64.whl", hash = "sha256:7de0b7dfeedc504421032afba845ae2a7bcc32ddfb07dae2c3ca5442f821c344", size = 3171493, upload-time = "2026-01-29T23:03:37.775Z" }, + { url = "https://files.pythonhosted.org/packages/7d/f2/1e8f8affe51e12a26f3a8a8a4277d6e60aa89d0a66512f63b1e799d424a4/debugpy-1.8.20-cp311-cp311-win32.whl", hash = "sha256:773e839380cf459caf73cc533ea45ec2737a5cc184cf1b3b796cd4fd98504fec", size = 5209240, upload-time = "2026-01-29T23:03:39.109Z" }, + { url = "https://files.pythonhosted.org/packages/d5/92/1cb532e88560cbee973396254b21bece8c5d7c2ece958a67afa08c9f10dc/debugpy-1.8.20-cp311-cp311-win_amd64.whl", hash = "sha256:1f7650546e0eded1902d0f6af28f787fa1f1dbdbc97ddabaf1cd963a405930cb", size = 5233481, upload-time = "2026-01-29T23:03:40.659Z" }, + { url = "https://files.pythonhosted.org/packages/14/57/7f34f4736bfb6e00f2e4c96351b07805d83c9a7b33d28580ae01374430f7/debugpy-1.8.20-cp312-cp312-macosx_15_0_universal2.whl", hash = "sha256:4ae3135e2089905a916909ef31922b2d733d756f66d87345b3e5e52b7a55f13d", size = 2550686, upload-time = "2026-01-29T23:03:42.023Z" }, + { url = "https://files.pythonhosted.org/packages/ab/78/b193a3975ca34458f6f0e24aaf5c3e3da72f5401f6054c0dfd004b41726f/debugpy-1.8.20-cp312-cp312-manylinux_2_34_x86_64.whl", hash = "sha256:88f47850a4284b88bd2bfee1f26132147d5d504e4e86c22485dfa44b97e19b4b", size = 4310588, upload-time = "2026-01-29T23:03:43.314Z" }, + { url = "https://files.pythonhosted.org/packages/c1/55/f14deb95eaf4f30f07ef4b90a8590fc05d9e04df85ee379712f6fb6736d7/debugpy-1.8.20-cp312-cp312-win32.whl", hash = "sha256:4057ac68f892064e5f98209ab582abfee3b543fb55d2e87610ddc133a954d390", size = 5331372, upload-time = "2026-01-29T23:03:45.526Z" }, + { url = "https://files.pythonhosted.org/packages/a1/39/2bef246368bd42f9bd7cba99844542b74b84dacbdbea0833e610f384fee8/debugpy-1.8.20-cp312-cp312-win_amd64.whl", hash = "sha256:a1a8f851e7cf171330679ef6997e9c579ef6dd33c9098458bd9986a0f4ca52e3", size = 5372835, upload-time = "2026-01-29T23:03:47.245Z" }, + { url = "https://files.pythonhosted.org/packages/15/e2/fc500524cc6f104a9d049abc85a0a8b3f0d14c0a39b9c140511c61e5b40b/debugpy-1.8.20-cp313-cp313-macosx_15_0_universal2.whl", hash = "sha256:5dff4bb27027821fdfcc9e8f87309a28988231165147c31730128b1c983e282a", size = 2539560, upload-time = "2026-01-29T23:03:48.738Z" }, + { url = "https://files.pythonhosted.org/packages/90/83/fb33dcea789ed6018f8da20c5a9bc9d82adc65c0c990faed43f7c955da46/debugpy-1.8.20-cp313-cp313-manylinux_2_34_x86_64.whl", hash = "sha256:84562982dd7cf5ebebfdea667ca20a064e096099997b175fe204e86817f64eaf", size = 4293272, upload-time = "2026-01-29T23:03:50.169Z" }, + { url = "https://files.pythonhosted.org/packages/a6/25/b1e4a01bfb824d79a6af24b99ef291e24189080c93576dfd9b1a2815cd0f/debugpy-1.8.20-cp313-cp313-win32.whl", hash = "sha256:da11dea6447b2cadbf8ce2bec59ecea87cc18d2c574980f643f2d2dfe4862393", size = 5331208, upload-time = "2026-01-29T23:03:51.547Z" }, + { url = "https://files.pythonhosted.org/packages/13/f7/a0b368ce54ffff9e9028c098bd2d28cfc5b54f9f6c186929083d4c60ba58/debugpy-1.8.20-cp313-cp313-win_amd64.whl", hash = "sha256:eb506e45943cab2efb7c6eafdd65b842f3ae779f020c82221f55aca9de135ed7", size = 5372930, upload-time = "2026-01-29T23:03:53.585Z" }, + { url = "https://files.pythonhosted.org/packages/33/2e/f6cb9a8a13f5058f0a20fe09711a7b726232cd5a78c6a7c05b2ec726cff9/debugpy-1.8.20-cp314-cp314-macosx_15_0_universal2.whl", hash = "sha256:9c74df62fc064cd5e5eaca1353a3ef5a5d50da5eb8058fcef63106f7bebe6173", size = 2538066, upload-time = "2026-01-29T23:03:54.999Z" }, + { url = "https://files.pythonhosted.org/packages/c5/56/6ddca50b53624e1ca3ce1d1e49ff22db46c47ea5fb4c0cc5c9b90a616364/debugpy-1.8.20-cp314-cp314-manylinux_2_34_x86_64.whl", hash = "sha256:077a7447589ee9bc1ff0cdf443566d0ecf540ac8aa7333b775ebcb8ce9f4ecad", size = 4269425, upload-time = "2026-01-29T23:03:56.518Z" }, + { url = "https://files.pythonhosted.org/packages/c5/d9/d64199c14a0d4c476df46c82470a3ce45c8d183a6796cfb5e66533b3663c/debugpy-1.8.20-cp314-cp314-win32.whl", hash = "sha256:352036a99dd35053b37b7803f748efc456076f929c6a895556932eaf2d23b07f", size = 5331407, upload-time = "2026-01-29T23:03:58.481Z" }, + { url = "https://files.pythonhosted.org/packages/e0/d9/1f07395b54413432624d61524dfd98c1a7c7827d2abfdb8829ac92638205/debugpy-1.8.20-cp314-cp314-win_amd64.whl", hash = "sha256:a98eec61135465b062846112e5ecf2eebb855305acc1dfbae43b72903b8ab5be", size = 5372521, upload-time = "2026-01-29T23:03:59.864Z" }, + { url = "https://files.pythonhosted.org/packages/e0/c3/7f67dea8ccf8fdcb9c99033bbe3e90b9e7395415843accb81428c441be2d/debugpy-1.8.20-py2.py3-none-any.whl", hash = "sha256:5be9bed9ae3be00665a06acaa48f8329d2b9632f15fd09f6a9a8c8d9907e54d7", size = 5337658, upload-time = "2026-01-29T23:04:17.404Z" }, +] + +[[package]] +name = "decorator" +version = "5.2.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/43/fa/6d96a0978d19e17b68d634497769987b16c8f4cd0a7a05048bec693caa6b/decorator-5.2.1.tar.gz", hash = "sha256:65f266143752f734b0a7cc83c46f4618af75b8c5911b00ccb61d0ac9b6da0360", size = 56711, upload-time = "2025-02-24T04:41:34.073Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/4e/8c/f3147f5c4b73e7550fe5f9352eaa956ae838d5c51eb58e7a25b9f3e2643b/decorator-5.2.1-py3-none-any.whl", hash = "sha256:d316bb415a2d9e2d2b3abcc4084c6502fc09240e292cd76a76afc106a1c8e04a", size = 9190, upload-time = "2025-02-24T04:41:32.565Z" }, +] + +[[package]] +name = "deeplc" +version = "4.0.0a2" +source = { editable = "." } +dependencies = [ + { name = "click" }, + { name = "numpy" }, + { name = "onnx2torch" }, + { name = "pandas" }, + { name = "psm-utils" }, + { name = "rich" }, + { name = "scikit-learn" }, + { name = "torch" }, +] + +[package.optional-dependencies] +gui = [ + { name = "nicegui" }, + { name = "plotly" }, + { name = "pywebview" }, +] +web = [ + { name = "nicegui" }, + { name = "plotly" }, +] + +[package.dev-dependencies] +dev = [ + { name = "pyinstaller" }, + { name = "pytest" }, + { name = "ruff" }, +] +docs = [ + { name = "numpydoc" }, + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, + { name = "sphinx-autobuild" }, + { name = "sphinx-click" }, + { name = "sphinx-mdinclude" }, + { name = "sphinx-rtd-theme" }, +] +notebooks = [ + { name = "ipykernel" }, + { name = "ipywidgets" }, + { name = "matplotlib" }, + { name = "seaborn" }, +] + +[package.metadata] +requires-dist = [ + { name = "click", specifier = ">=8,<9" }, + { name = "nicegui", marker = "extra == 'gui'", specifier = ">=3,<4" }, + { name = "nicegui", marker = "extra == 'web'", specifier = ">=3,<4" }, + { name = "numpy", specifier = ">=1.17,<3" }, + { name = "onnx2torch", specifier = ">=1.5,<2" }, + { name = "pandas", specifier = ">=0.25,<3" }, + { name = "plotly", marker = "extra == 'gui'", specifier = ">=5,<6" }, + { name = "plotly", marker = "extra == 'web'", specifier = ">=5,<6" }, + { name = "psm-utils", specifier = ">=1.5,<2" }, + { name = "pywebview", marker = "extra == 'gui'", specifier = ">=5,<6" }, + { name = "rich", specifier = ">=13,<15" }, + { name = "scikit-learn", specifier = ">=1.2.0,<2" }, + { name = "torch", specifier = ">=2.6.0,<3" }, +] +provides-extras = ["gui", "web"] + +[package.metadata.requires-dev] +dev = [ + { name = "pyinstaller", specifier = ">=6.21.0" }, + { name = "pytest" }, + { name = "ruff" }, +] +docs = [ + { name = "numpydoc", specifier = ">=1,<2" }, + { name = "sphinx" }, + { name = "sphinx-autobuild" }, + { name = "sphinx-click" }, + { name = "sphinx-mdinclude" }, + { name = "sphinx-rtd-theme" }, +] +notebooks = [ + { name = "ipykernel" }, + { name = "ipywidgets" }, + { name = "matplotlib" }, + { name = "seaborn" }, +] + +[[package]] +name = "docutils" +version = "0.22.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ae/b6/03bb70946330e88ffec97aefd3ea75ba575cb2e762061e0e62a213befee8/docutils-0.22.4.tar.gz", hash = "sha256:4db53b1fde9abecbb74d91230d32ab626d94f6badfc575d6db9194a49df29968", size = 2291750, upload-time = "2025-12-18T19:00:26.443Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/02/10/5da547df7a391dcde17f59520a231527b8571e6f46fc8efb02ccb370ab12/docutils-0.22.4-py3-none-any.whl", hash = "sha256:d0013f540772d1420576855455d050a2180186c91c15779301ac2ccb3eeb68de", size = 633196, upload-time = "2025-12-18T19:00:18.077Z" }, +] + +[[package]] +name = "executing" +version = "2.2.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/cc/28/c14e053b6762b1044f34a13aab6859bbf40456d37d23aa286ac24cfd9a5d/executing-2.2.1.tar.gz", hash = "sha256:3632cc370565f6648cc328b32435bd120a1e4ebb20c77e3fdde9a13cd1e533c4", size = 1129488, upload-time = "2025-09-01T09:48:10.866Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c1/ea/53f2148663b321f21b5a606bd5f191517cf40b7072c0497d3c92c4a13b1e/executing-2.2.1-py2.py3-none-any.whl", hash = "sha256:760643d3452b4d777d295bb167ccc74c64a81df23fb5e08eff250c425a4b2017", size = 28317, upload-time = "2025-09-01T09:48:08.5Z" }, +] + +[[package]] +name = "fastapi" +version = "0.138.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "annotated-doc" }, + { name = "pydantic" }, + { name = "starlette" }, + { name = "typing-extensions" }, + { name = "typing-inspection" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/0c/a9/9f8f7e00195c29836e9bf58bbbaf579e29878b8a67851efff93d9b6d4eb7/fastapi-0.138.2.tar.gz", hash = "sha256:6432359d067a432134620e7c5e4c6e5063e7f37815bbbbf20acef14b0d2e3fc8", size = 420423, upload-time = "2026-06-29T12:44:12.556Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f2/b3/38be2c074bdd0c986340db1d72d7b2321b805b1c5a68069aa00b5d31fd02/fastapi-0.138.2-py3-none-any.whl", hash = "sha256:db90c1ffb5517fba5d4a9f80e866daa008747e646310c9ce155c8c535f9d1615", size = 129271, upload-time = "2026-06-29T12:44:13.905Z" }, +] + +[[package]] +name = "filelock" +version = "3.24.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/73/92/a8e2479937ff39185d20dd6a851c1a63e55849e447a55e798cc2e1f49c65/filelock-3.24.3.tar.gz", hash = "sha256:011a5644dc937c22699943ebbfc46e969cdde3e171470a6e40b9533e5a72affa", size = 37935, upload-time = "2026-02-19T00:48:20.543Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/9c/0f/5d0c71a1aefeb08efff26272149e07ab922b64f46c63363756224bd6872e/filelock-3.24.3-py3-none-any.whl", hash = "sha256:426e9a4660391f7f8a810d71b0555bce9008b0a1cc342ab1f6947d37639e002d", size = 24331, upload-time = "2026-02-19T00:48:18.465Z" }, +] + +[[package]] +name = "fonttools" +version = "4.61.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ec/ca/cf17b88a8df95691275a3d77dc0a5ad9907f328ae53acbe6795da1b2f5ed/fonttools-4.61.1.tar.gz", hash = "sha256:6675329885c44657f826ef01d9e4fb33b9158e9d93c537d84ad8399539bc6f69", size = 3565756, upload-time = "2025-12-12T17:31:24.246Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/69/12/bf9f4eaa2fad039356cc627587e30ed008c03f1cebd3034376b5ee8d1d44/fonttools-4.61.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:c6604b735bb12fef8e0efd5578c9fb5d3d8532d5001ea13a19cddf295673ee09", size = 2852213, upload-time = "2025-12-12T17:29:46.675Z" }, + { url = "https://files.pythonhosted.org/packages/ac/49/4138d1acb6261499bedde1c07f8c2605d1d8f9d77a151e5507fd3ef084b6/fonttools-4.61.1-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:5ce02f38a754f207f2f06557523cd39a06438ba3aafc0639c477ac409fc64e37", size = 2401689, upload-time = "2025-12-12T17:29:48.769Z" }, + { url = "https://files.pythonhosted.org/packages/e5/fe/e6ce0fe20a40e03aef906af60aa87668696f9e4802fa283627d0b5ed777f/fonttools-4.61.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:77efb033d8d7ff233385f30c62c7c79271c8885d5c9657d967ede124671bbdfb", size = 5058809, upload-time = "2025-12-12T17:29:51.701Z" }, + { url = "https://files.pythonhosted.org/packages/79/61/1ca198af22f7dd22c17ab86e9024ed3c06299cfdb08170640e9996d501a0/fonttools-4.61.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:75c1a6dfac6abd407634420c93864a1e274ebc1c7531346d9254c0d8f6ca00f9", size = 5036039, upload-time = "2025-12-12T17:29:53.659Z" }, + { url = "https://files.pythonhosted.org/packages/99/cc/fa1801e408586b5fce4da9f5455af8d770f4fc57391cd5da7256bb364d38/fonttools-4.61.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:0de30bfe7745c0d1ffa2b0b7048fb7123ad0d71107e10ee090fa0b16b9452e87", size = 5034714, upload-time = "2025-12-12T17:29:55.592Z" }, + { url = "https://files.pythonhosted.org/packages/bf/aa/b7aeafe65adb1b0a925f8f25725e09f078c635bc22754f3fecb7456955b0/fonttools-4.61.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:58b0ee0ab5b1fc9921eccfe11d1435added19d6494dde14e323f25ad2bc30c56", size = 5158648, upload-time = "2025-12-12T17:29:57.861Z" }, + { url = "https://files.pythonhosted.org/packages/99/f9/08ea7a38663328881384c6e7777bbefc46fd7d282adfd87a7d2b84ec9d50/fonttools-4.61.1-cp311-cp311-win32.whl", hash = "sha256:f79b168428351d11e10c5aeb61a74e1851ec221081299f4cf56036a95431c43a", size = 2280681, upload-time = "2025-12-12T17:29:59.943Z" }, + { url = "https://files.pythonhosted.org/packages/07/ad/37dd1ae5fa6e01612a1fbb954f0927681f282925a86e86198ccd7b15d515/fonttools-4.61.1-cp311-cp311-win_amd64.whl", hash = "sha256:fe2efccb324948a11dd09d22136fe2ac8a97d6c1347cf0b58a911dcd529f66b7", size = 2331951, upload-time = "2025-12-12T17:30:02.254Z" }, + { url = "https://files.pythonhosted.org/packages/6f/16/7decaa24a1bd3a70c607b2e29f0adc6159f36a7e40eaba59846414765fd4/fonttools-4.61.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:f3cb4a569029b9f291f88aafc927dd53683757e640081ca8c412781ea144565e", size = 2851593, upload-time = "2025-12-12T17:30:04.225Z" }, + { url = "https://files.pythonhosted.org/packages/94/98/3c4cb97c64713a8cf499b3245c3bf9a2b8fd16a3e375feff2aed78f96259/fonttools-4.61.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:41a7170d042e8c0024703ed13b71893519a1a6d6e18e933e3ec7507a2c26a4b2", size = 2400231, upload-time = "2025-12-12T17:30:06.47Z" }, + { url = "https://files.pythonhosted.org/packages/b7/37/82dbef0f6342eb01f54bca073ac1498433d6ce71e50c3c3282b655733b31/fonttools-4.61.1-cp312-cp312-manylinux1_x86_64.manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:10d88e55330e092940584774ee5e8a6971b01fc2f4d3466a1d6c158230880796", size = 4954103, upload-time = "2025-12-12T17:30:08.432Z" }, + { url = "https://files.pythonhosted.org/packages/6c/44/f3aeac0fa98e7ad527f479e161aca6c3a1e47bb6996b053d45226fe37bf2/fonttools-4.61.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:15acc09befd16a0fb8a8f62bc147e1a82817542d72184acca9ce6e0aeda9fa6d", size = 5004295, upload-time = "2025-12-12T17:30:10.56Z" }, + { url = "https://files.pythonhosted.org/packages/14/e8/7424ced75473983b964d09f6747fa09f054a6d656f60e9ac9324cf40c743/fonttools-4.61.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:e6bcdf33aec38d16508ce61fd81838f24c83c90a1d1b8c68982857038673d6b8", size = 4944109, upload-time = "2025-12-12T17:30:12.874Z" }, + { url = "https://files.pythonhosted.org/packages/c8/8b/6391b257fa3d0b553d73e778f953a2f0154292a7a7a085e2374b111e5410/fonttools-4.61.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:5fade934607a523614726119164ff621e8c30e8fa1ffffbbd358662056ba69f0", size = 5093598, upload-time = "2025-12-12T17:30:15.79Z" }, + { url = "https://files.pythonhosted.org/packages/d9/71/fd2ea96cdc512d92da5678a1c98c267ddd4d8c5130b76d0f7a80f9a9fde8/fonttools-4.61.1-cp312-cp312-win32.whl", hash = "sha256:75da8f28eff26defba42c52986de97b22106cb8f26515b7c22443ebc9c2d3261", size = 2269060, upload-time = "2025-12-12T17:30:18.058Z" }, + { url = "https://files.pythonhosted.org/packages/80/3b/a3e81b71aed5a688e89dfe0e2694b26b78c7d7f39a5ffd8a7d75f54a12a8/fonttools-4.61.1-cp312-cp312-win_amd64.whl", hash = "sha256:497c31ce314219888c0e2fce5ad9178ca83fe5230b01a5006726cdf3ac9f24d9", size = 2319078, upload-time = "2025-12-12T17:30:22.862Z" }, + { url = "https://files.pythonhosted.org/packages/4b/cf/00ba28b0990982530addb8dc3e9e6f2fa9cb5c20df2abdda7baa755e8fe1/fonttools-4.61.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:8c56c488ab471628ff3bfa80964372fc13504ece601e0d97a78ee74126b2045c", size = 2846454, upload-time = "2025-12-12T17:30:24.938Z" }, + { url = "https://files.pythonhosted.org/packages/5a/ca/468c9a8446a2103ae645d14fee3f610567b7042aba85031c1c65e3ef7471/fonttools-4.61.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:dc492779501fa723b04d0ab1f5be046797fee17d27700476edc7ee9ae535a61e", size = 2398191, upload-time = "2025-12-12T17:30:27.343Z" }, + { url = "https://files.pythonhosted.org/packages/a3/4b/d67eedaed19def5967fade3297fed8161b25ba94699efc124b14fb68cdbc/fonttools-4.61.1-cp313-cp313-manylinux1_x86_64.manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:64102ca87e84261419c3747a0d20f396eb024bdbeb04c2bfb37e2891f5fadcb5", size = 4928410, upload-time = "2025-12-12T17:30:29.771Z" }, + { url = "https://files.pythonhosted.org/packages/b0/8d/6fb3494dfe61a46258cd93d979cf4725ded4eb46c2a4ca35e4490d84daea/fonttools-4.61.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4c1b526c8d3f615a7b1867f38a9410849c8f4aef078535742198e942fba0e9bd", size = 4984460, upload-time = "2025-12-12T17:30:32.073Z" }, + { url = "https://files.pythonhosted.org/packages/f7/f1/a47f1d30b3dc00d75e7af762652d4cbc3dff5c2697a0dbd5203c81afd9c3/fonttools-4.61.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:41ed4b5ec103bd306bb68f81dc166e77409e5209443e5773cb4ed837bcc9b0d3", size = 4925800, upload-time = "2025-12-12T17:30:34.339Z" }, + { url = "https://files.pythonhosted.org/packages/a7/01/e6ae64a0981076e8a66906fab01539799546181e32a37a0257b77e4aa88b/fonttools-4.61.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:b501c862d4901792adaec7c25b1ecc749e2662543f68bb194c42ba18d6eec98d", size = 5067859, upload-time = "2025-12-12T17:30:36.593Z" }, + { url = "https://files.pythonhosted.org/packages/73/aa/28e40b8d6809a9b5075350a86779163f074d2b617c15d22343fce81918db/fonttools-4.61.1-cp313-cp313-win32.whl", hash = "sha256:4d7092bb38c53bbc78e9255a59158b150bcdc115a1e3b3ce0b5f267dc35dd63c", size = 2267821, upload-time = "2025-12-12T17:30:38.478Z" }, + { url = "https://files.pythonhosted.org/packages/1a/59/453c06d1d83dc0951b69ef692d6b9f1846680342927df54e9a1ca91c6f90/fonttools-4.61.1-cp313-cp313-win_amd64.whl", hash = "sha256:21e7c8d76f62ab13c9472ccf74515ca5b9a761d1bde3265152a6dc58700d895b", size = 2318169, upload-time = "2025-12-12T17:30:40.951Z" }, + { url = "https://files.pythonhosted.org/packages/32/8f/4e7bf82c0cbb738d3c2206c920ca34ca74ef9dabde779030145d28665104/fonttools-4.61.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:fff4f534200a04b4a36e7ae3cb74493afe807b517a09e99cb4faa89a34ed6ecd", size = 2846094, upload-time = "2025-12-12T17:30:43.511Z" }, + { url = "https://files.pythonhosted.org/packages/71/09/d44e45d0a4f3a651f23a1e9d42de43bc643cce2971b19e784cc67d823676/fonttools-4.61.1-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:d9203500f7c63545b4ce3799319fe4d9feb1a1b89b28d3cb5abd11b9dd64147e", size = 2396589, upload-time = "2025-12-12T17:30:45.681Z" }, + { url = "https://files.pythonhosted.org/packages/89/18/58c64cafcf8eb677a99ef593121f719e6dcbdb7d1c594ae5a10d4997ca8a/fonttools-4.61.1-cp314-cp314-manylinux1_x86_64.manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:fa646ecec9528bef693415c79a86e733c70a4965dd938e9a226b0fc64c9d2e6c", size = 4877892, upload-time = "2025-12-12T17:30:47.709Z" }, + { url = "https://files.pythonhosted.org/packages/8a/ec/9e6b38c7ba1e09eb51db849d5450f4c05b7e78481f662c3b79dbde6f3d04/fonttools-4.61.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:11f35ad7805edba3aac1a3710d104592df59f4b957e30108ae0ba6c10b11dd75", size = 4972884, upload-time = "2025-12-12T17:30:49.656Z" }, + { url = "https://files.pythonhosted.org/packages/5e/87/b5339da8e0256734ba0dbbf5b6cdebb1dd79b01dc8c270989b7bcd465541/fonttools-4.61.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:b931ae8f62db78861b0ff1ac017851764602288575d65b8e8ff1963fed419063", size = 4924405, upload-time = "2025-12-12T17:30:51.735Z" }, + { url = "https://files.pythonhosted.org/packages/0b/47/e3409f1e1e69c073a3a6fd8cb886eb18c0bae0ee13db2c8d5e7f8495e8b7/fonttools-4.61.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:b148b56f5de675ee16d45e769e69f87623a4944f7443850bf9a9376e628a89d2", size = 5035553, upload-time = "2025-12-12T17:30:54.823Z" }, + { url = "https://files.pythonhosted.org/packages/bf/b6/1f6600161b1073a984294c6c031e1a56ebf95b6164249eecf30012bb2e38/fonttools-4.61.1-cp314-cp314-win32.whl", hash = "sha256:9b666a475a65f4e839d3d10473fad6d47e0a9db14a2f4a224029c5bfde58ad2c", size = 2271915, upload-time = "2025-12-12T17:30:57.913Z" }, + { url = "https://files.pythonhosted.org/packages/52/7b/91e7b01e37cc8eb0e1f770d08305b3655e4f002fc160fb82b3390eabacf5/fonttools-4.61.1-cp314-cp314-win_amd64.whl", hash = "sha256:4f5686e1fe5fce75d82d93c47a438a25bf0d1319d2843a926f741140b2b16e0c", size = 2323487, upload-time = "2025-12-12T17:30:59.804Z" }, + { url = "https://files.pythonhosted.org/packages/39/5c/908ad78e46c61c3e3ed70c3b58ff82ab48437faf84ec84f109592cabbd9f/fonttools-4.61.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:e76ce097e3c57c4bcb67c5aa24a0ecdbd9f74ea9219997a707a4061fbe2707aa", size = 2929571, upload-time = "2025-12-12T17:31:02.574Z" }, + { url = "https://files.pythonhosted.org/packages/bd/41/975804132c6dea64cdbfbaa59f3518a21c137a10cccf962805b301ac6ab2/fonttools-4.61.1-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:9cfef3ab326780c04d6646f68d4b4742aae222e8b8ea1d627c74e38afcbc9d91", size = 2435317, upload-time = "2025-12-12T17:31:04.974Z" }, + { url = "https://files.pythonhosted.org/packages/b0/5a/aef2a0a8daf1ebaae4cfd83f84186d4a72ee08fd6a8451289fcd03ffa8a4/fonttools-4.61.1-cp314-cp314t-manylinux1_x86_64.manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:a75c301f96db737e1c5ed5fd7d77d9c34466de16095a266509e13da09751bd19", size = 4882124, upload-time = "2025-12-12T17:31:07.456Z" }, + { url = "https://files.pythonhosted.org/packages/80/33/d6db3485b645b81cea538c9d1c9219d5805f0877fda18777add4671c5240/fonttools-4.61.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:91669ccac46bbc1d09e9273546181919064e8df73488ea087dcac3e2968df9ba", size = 5100391, upload-time = "2025-12-12T17:31:09.732Z" }, + { url = "https://files.pythonhosted.org/packages/6c/d6/675ba631454043c75fcf76f0ca5463eac8eb0666ea1d7badae5fea001155/fonttools-4.61.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:c33ab3ca9d3ccd581d58e989d67554e42d8d4ded94ab3ade3508455fe70e65f7", size = 4978800, upload-time = "2025-12-12T17:31:11.681Z" }, + { url = "https://files.pythonhosted.org/packages/7f/33/d3ec753d547a8d2bdaedd390d4a814e8d5b45a093d558f025c6b990b554c/fonttools-4.61.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:664c5a68ec406f6b1547946683008576ef8b38275608e1cee6c061828171c118", size = 5006426, upload-time = "2025-12-12T17:31:13.764Z" }, + { url = "https://files.pythonhosted.org/packages/b4/40/cc11f378b561a67bea850ab50063366a0d1dd3f6d0a30ce0f874b0ad5664/fonttools-4.61.1-cp314-cp314t-win32.whl", hash = "sha256:aed04cabe26f30c1647ef0e8fbb207516fd40fe9472e9439695f5c6998e60ac5", size = 2335377, upload-time = "2025-12-12T17:31:16.49Z" }, + { url = "https://files.pythonhosted.org/packages/e4/ff/c9a2b66b39f8628531ea58b320d66d951267c98c6a38684daa8f50fb02f8/fonttools-4.61.1-cp314-cp314t-win_amd64.whl", hash = "sha256:2180f14c141d2f0f3da43f3a81bc8aa4684860f6b0e6f9e165a4831f24e6a23b", size = 2400613, upload-time = "2025-12-12T17:31:18.769Z" }, + { url = "https://files.pythonhosted.org/packages/c7/4e/ce75a57ff3aebf6fc1f4e9d508b8e5810618a33d900ad6c19eb30b290b97/fonttools-4.61.1-py3-none-any.whl", hash = "sha256:17d2bf5d541add43822bcf0c43d7d847b160c9bb01d15d5007d84e2217aaa371", size = 1148996, upload-time = "2025-12-12T17:31:21.03Z" }, +] + +[[package]] +name = "frozenlist" +version = "1.8.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/2d/f5/c831fac6cc817d26fd54c7eaccd04ef7e0288806943f7cc5bbf69f3ac1f0/frozenlist-1.8.0.tar.gz", hash = "sha256:3ede829ed8d842f6cd48fc7081d7a41001a56f1f38603f9d49bf3020d59a31ad", size = 45875, upload-time = "2025-10-06T05:38:17.865Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/bc/03/077f869d540370db12165c0aa51640a873fb661d8b315d1d4d67b284d7ac/frozenlist-1.8.0-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:09474e9831bc2b2199fad6da3c14c7b0fbdd377cce9d3d77131be28906cb7d84", size = 86912, upload-time = "2025-10-06T05:35:45.98Z" }, + { url = "https://files.pythonhosted.org/packages/df/b5/7610b6bd13e4ae77b96ba85abea1c8cb249683217ef09ac9e0ae93f25a91/frozenlist-1.8.0-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:17c883ab0ab67200b5f964d2b9ed6b00971917d5d8a92df149dc2c9779208ee9", size = 50046, upload-time = "2025-10-06T05:35:47.009Z" }, + { url = "https://files.pythonhosted.org/packages/6e/ef/0e8f1fe32f8a53dd26bdd1f9347efe0778b0fddf62789ea683f4cc7d787d/frozenlist-1.8.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:fa47e444b8ba08fffd1c18e8cdb9a75db1b6a27f17507522834ad13ed5922b93", size = 50119, upload-time = "2025-10-06T05:35:48.38Z" }, + { url = "https://files.pythonhosted.org/packages/11/b1/71a477adc7c36e5fb628245dfbdea2166feae310757dea848d02bd0689fd/frozenlist-1.8.0-cp311-cp311-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:2552f44204b744fba866e573be4c1f9048d6a324dfe14475103fd51613eb1d1f", size = 231067, upload-time = "2025-10-06T05:35:49.97Z" }, + { url = "https://files.pythonhosted.org/packages/45/7e/afe40eca3a2dc19b9904c0f5d7edfe82b5304cb831391edec0ac04af94c2/frozenlist-1.8.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:957e7c38f250991e48a9a73e6423db1bb9dd14e722a10f6b8bb8e16a0f55f695", size = 233160, upload-time = "2025-10-06T05:35:51.729Z" }, + { url = "https://files.pythonhosted.org/packages/a6/aa/7416eac95603ce428679d273255ffc7c998d4132cfae200103f164b108aa/frozenlist-1.8.0-cp311-cp311-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:8585e3bb2cdea02fc88ffa245069c36555557ad3609e83be0ec71f54fd4abb52", size = 228544, upload-time = "2025-10-06T05:35:53.246Z" }, + { url = "https://files.pythonhosted.org/packages/8b/3d/2a2d1f683d55ac7e3875e4263d28410063e738384d3adc294f5ff3d7105e/frozenlist-1.8.0-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:edee74874ce20a373d62dc28b0b18b93f645633c2943fd90ee9d898550770581", size = 243797, upload-time = "2025-10-06T05:35:54.497Z" }, + { url = "https://files.pythonhosted.org/packages/78/1e/2d5565b589e580c296d3bb54da08d206e797d941a83a6fdea42af23be79c/frozenlist-1.8.0-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:c9a63152fe95756b85f31186bddf42e4c02c6321207fd6601a1c89ebac4fe567", size = 247923, upload-time = "2025-10-06T05:35:55.861Z" }, + { url = "https://files.pythonhosted.org/packages/aa/c3/65872fcf1d326a7f101ad4d86285c403c87be7d832b7470b77f6d2ed5ddc/frozenlist-1.8.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:b6db2185db9be0a04fecf2f241c70b63b1a242e2805be291855078f2b404dd6b", size = 230886, upload-time = "2025-10-06T05:35:57.399Z" }, + { url = "https://files.pythonhosted.org/packages/a0/76/ac9ced601d62f6956f03cc794f9e04c81719509f85255abf96e2510f4265/frozenlist-1.8.0-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:f4be2e3d8bc8aabd566f8d5b8ba7ecc09249d74ba3c9ed52e54dc23a293f0b92", size = 245731, upload-time = "2025-10-06T05:35:58.563Z" }, + { url = "https://files.pythonhosted.org/packages/b9/49/ecccb5f2598daf0b4a1415497eba4c33c1e8ce07495eb07d2860c731b8d5/frozenlist-1.8.0-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:c8d1634419f39ea6f5c427ea2f90ca85126b54b50837f31497f3bf38266e853d", size = 241544, upload-time = "2025-10-06T05:35:59.719Z" }, + { url = "https://files.pythonhosted.org/packages/53/4b/ddf24113323c0bbcc54cb38c8b8916f1da7165e07b8e24a717b4a12cbf10/frozenlist-1.8.0-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:1a7fa382a4a223773ed64242dbe1c9c326ec09457e6b8428efb4118c685c3dfd", size = 241806, upload-time = "2025-10-06T05:36:00.959Z" }, + { url = "https://files.pythonhosted.org/packages/a7/fb/9b9a084d73c67175484ba2789a59f8eebebd0827d186a8102005ce41e1ba/frozenlist-1.8.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:11847b53d722050808926e785df837353bd4d75f1d494377e59b23594d834967", size = 229382, upload-time = "2025-10-06T05:36:02.22Z" }, + { url = "https://files.pythonhosted.org/packages/95/a3/c8fb25aac55bf5e12dae5c5aa6a98f85d436c1dc658f21c3ac73f9fa95e5/frozenlist-1.8.0-cp311-cp311-win32.whl", hash = "sha256:27c6e8077956cf73eadd514be8fb04d77fc946a7fe9f7fe167648b0b9085cc25", size = 39647, upload-time = "2025-10-06T05:36:03.409Z" }, + { url = "https://files.pythonhosted.org/packages/0a/f5/603d0d6a02cfd4c8f2a095a54672b3cf967ad688a60fb9faf04fc4887f65/frozenlist-1.8.0-cp311-cp311-win_amd64.whl", hash = "sha256:ac913f8403b36a2c8610bbfd25b8013488533e71e62b4b4adce9c86c8cea905b", size = 44064, upload-time = "2025-10-06T05:36:04.368Z" }, + { url = "https://files.pythonhosted.org/packages/5d/16/c2c9ab44e181f043a86f9a8f84d5124b62dbcb3a02c0977ec72b9ac1d3e0/frozenlist-1.8.0-cp311-cp311-win_arm64.whl", hash = "sha256:d4d3214a0f8394edfa3e303136d0575eece0745ff2b47bd2cb2e66dd92d4351a", size = 39937, upload-time = "2025-10-06T05:36:05.669Z" }, + { url = "https://files.pythonhosted.org/packages/69/29/948b9aa87e75820a38650af445d2ef2b6b8a6fab1a23b6bb9e4ef0be2d59/frozenlist-1.8.0-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:78f7b9e5d6f2fdb88cdde9440dc147259b62b9d3b019924def9f6478be254ac1", size = 87782, upload-time = "2025-10-06T05:36:06.649Z" }, + { url = "https://files.pythonhosted.org/packages/64/80/4f6e318ee2a7c0750ed724fa33a4bdf1eacdc5a39a7a24e818a773cd91af/frozenlist-1.8.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:229bf37d2e4acdaf808fd3f06e854a4a7a3661e871b10dc1f8f1896a3b05f18b", size = 50594, upload-time = "2025-10-06T05:36:07.69Z" }, + { url = "https://files.pythonhosted.org/packages/2b/94/5c8a2b50a496b11dd519f4a24cb5496cf125681dd99e94c604ccdea9419a/frozenlist-1.8.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:f833670942247a14eafbb675458b4e61c82e002a148f49e68257b79296e865c4", size = 50448, upload-time = "2025-10-06T05:36:08.78Z" }, + { url = "https://files.pythonhosted.org/packages/6a/bd/d91c5e39f490a49df14320f4e8c80161cfcce09f1e2cde1edd16a551abb3/frozenlist-1.8.0-cp312-cp312-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:494a5952b1c597ba44e0e78113a7266e656b9794eec897b19ead706bd7074383", size = 242411, upload-time = "2025-10-06T05:36:09.801Z" }, + { url = "https://files.pythonhosted.org/packages/8f/83/f61505a05109ef3293dfb1ff594d13d64a2324ac3482be2cedc2be818256/frozenlist-1.8.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:96f423a119f4777a4a056b66ce11527366a8bb92f54e541ade21f2374433f6d4", size = 243014, upload-time = "2025-10-06T05:36:11.394Z" }, + { url = "https://files.pythonhosted.org/packages/d8/cb/cb6c7b0f7d4023ddda30cf56b8b17494eb3a79e3fda666bf735f63118b35/frozenlist-1.8.0-cp312-cp312-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:3462dd9475af2025c31cc61be6652dfa25cbfb56cbbf52f4ccfe029f38decaf8", size = 234909, upload-time = "2025-10-06T05:36:12.598Z" }, + { url = "https://files.pythonhosted.org/packages/31/c5/cd7a1f3b8b34af009fb17d4123c5a778b44ae2804e3ad6b86204255f9ec5/frozenlist-1.8.0-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:c4c800524c9cd9bac5166cd6f55285957fcfc907db323e193f2afcd4d9abd69b", size = 250049, upload-time = "2025-10-06T05:36:14.065Z" }, + { url = "https://files.pythonhosted.org/packages/c0/01/2f95d3b416c584a1e7f0e1d6d31998c4a795f7544069ee2e0962a4b60740/frozenlist-1.8.0-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:d6a5df73acd3399d893dafc71663ad22534b5aa4f94e8a2fabfe856c3c1b6a52", size = 256485, upload-time = "2025-10-06T05:36:15.39Z" }, + { url = "https://files.pythonhosted.org/packages/ce/03/024bf7720b3abaebcff6d0793d73c154237b85bdf67b7ed55e5e9596dc9a/frozenlist-1.8.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:405e8fe955c2280ce66428b3ca55e12b3c4e9c336fb2103a4937e891c69a4a29", size = 237619, upload-time = "2025-10-06T05:36:16.558Z" }, + { url = "https://files.pythonhosted.org/packages/69/fa/f8abdfe7d76b731f5d8bd217827cf6764d4f1d9763407e42717b4bed50a0/frozenlist-1.8.0-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:908bd3f6439f2fef9e85031b59fd4f1297af54415fb60e4254a95f75b3cab3f3", size = 250320, upload-time = "2025-10-06T05:36:17.821Z" }, + { url = "https://files.pythonhosted.org/packages/f5/3c/b051329f718b463b22613e269ad72138cc256c540f78a6de89452803a47d/frozenlist-1.8.0-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:294e487f9ec720bd8ffcebc99d575f7eff3568a08a253d1ee1a0378754b74143", size = 246820, upload-time = "2025-10-06T05:36:19.046Z" }, + { url = "https://files.pythonhosted.org/packages/0f/ae/58282e8f98e444b3f4dd42448ff36fa38bef29e40d40f330b22e7108f565/frozenlist-1.8.0-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:74c51543498289c0c43656701be6b077f4b265868fa7f8a8859c197006efb608", size = 250518, upload-time = "2025-10-06T05:36:20.763Z" }, + { url = "https://files.pythonhosted.org/packages/8f/96/007e5944694d66123183845a106547a15944fbbb7154788cbf7272789536/frozenlist-1.8.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:776f352e8329135506a1d6bf16ac3f87bc25b28e765949282dcc627af36123aa", size = 239096, upload-time = "2025-10-06T05:36:22.129Z" }, + { url = "https://files.pythonhosted.org/packages/66/bb/852b9d6db2fa40be96f29c0d1205c306288f0684df8fd26ca1951d461a56/frozenlist-1.8.0-cp312-cp312-win32.whl", hash = "sha256:433403ae80709741ce34038da08511d4a77062aa924baf411ef73d1146e74faf", size = 39985, upload-time = "2025-10-06T05:36:23.661Z" }, + { url = "https://files.pythonhosted.org/packages/b8/af/38e51a553dd66eb064cdf193841f16f077585d4d28394c2fa6235cb41765/frozenlist-1.8.0-cp312-cp312-win_amd64.whl", hash = "sha256:34187385b08f866104f0c0617404c8eb08165ab1272e884abc89c112e9c00746", size = 44591, upload-time = "2025-10-06T05:36:24.958Z" }, + { url = "https://files.pythonhosted.org/packages/a7/06/1dc65480ab147339fecc70797e9c2f69d9cea9cf38934ce08df070fdb9cb/frozenlist-1.8.0-cp312-cp312-win_arm64.whl", hash = "sha256:fe3c58d2f5db5fbd18c2987cba06d51b0529f52bc3a6cdc33d3f4eab725104bd", size = 40102, upload-time = "2025-10-06T05:36:26.333Z" }, + { url = "https://files.pythonhosted.org/packages/2d/40/0832c31a37d60f60ed79e9dfb5a92e1e2af4f40a16a29abcc7992af9edff/frozenlist-1.8.0-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:8d92f1a84bb12d9e56f818b3a746f3efba93c1b63c8387a73dde655e1e42282a", size = 85717, upload-time = "2025-10-06T05:36:27.341Z" }, + { url = "https://files.pythonhosted.org/packages/30/ba/b0b3de23f40bc55a7057bd38434e25c34fa48e17f20ee273bbde5e0650f3/frozenlist-1.8.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:96153e77a591c8adc2ee805756c61f59fef4cf4073a9275ee86fe8cba41241f7", size = 49651, upload-time = "2025-10-06T05:36:28.855Z" }, + { url = "https://files.pythonhosted.org/packages/0c/ab/6e5080ee374f875296c4243c381bbdef97a9ac39c6e3ce1d5f7d42cb78d6/frozenlist-1.8.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:f21f00a91358803399890ab167098c131ec2ddd5f8f5fd5fe9c9f2c6fcd91e40", size = 49417, upload-time = "2025-10-06T05:36:29.877Z" }, + { url = "https://files.pythonhosted.org/packages/d5/4e/e4691508f9477ce67da2015d8c00acd751e6287739123113a9fca6f1604e/frozenlist-1.8.0-cp313-cp313-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:fb30f9626572a76dfe4293c7194a09fb1fe93ba94c7d4f720dfae3b646b45027", size = 234391, upload-time = "2025-10-06T05:36:31.301Z" }, + { url = "https://files.pythonhosted.org/packages/40/76/c202df58e3acdf12969a7895fd6f3bc016c642e6726aa63bd3025e0fc71c/frozenlist-1.8.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:eaa352d7047a31d87dafcacbabe89df0aa506abb5b1b85a2fb91bc3faa02d822", size = 233048, upload-time = "2025-10-06T05:36:32.531Z" }, + { url = "https://files.pythonhosted.org/packages/f9/c0/8746afb90f17b73ca5979c7a3958116e105ff796e718575175319b5bb4ce/frozenlist-1.8.0-cp313-cp313-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:03ae967b4e297f58f8c774c7eabcce57fe3c2434817d4385c50661845a058121", size = 226549, upload-time = "2025-10-06T05:36:33.706Z" }, + { url = "https://files.pythonhosted.org/packages/7e/eb/4c7eefc718ff72f9b6c4893291abaae5fbc0c82226a32dcd8ef4f7a5dbef/frozenlist-1.8.0-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f6292f1de555ffcc675941d65fffffb0a5bcd992905015f85d0592201793e0e5", size = 239833, upload-time = "2025-10-06T05:36:34.947Z" }, + { url = "https://files.pythonhosted.org/packages/c2/4e/e5c02187cf704224f8b21bee886f3d713ca379535f16893233b9d672ea71/frozenlist-1.8.0-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:29548f9b5b5e3460ce7378144c3010363d8035cea44bc0bf02d57f5a685e084e", size = 245363, upload-time = "2025-10-06T05:36:36.534Z" }, + { url = "https://files.pythonhosted.org/packages/1f/96/cb85ec608464472e82ad37a17f844889c36100eed57bea094518bf270692/frozenlist-1.8.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:ec3cc8c5d4084591b4237c0a272cc4f50a5b03396a47d9caaf76f5d7b38a4f11", size = 229314, upload-time = "2025-10-06T05:36:38.582Z" }, + { url = "https://files.pythonhosted.org/packages/5d/6f/4ae69c550e4cee66b57887daeebe006fe985917c01d0fff9caab9883f6d0/frozenlist-1.8.0-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:517279f58009d0b1f2e7c1b130b377a349405da3f7621ed6bfae50b10adf20c1", size = 243365, upload-time = "2025-10-06T05:36:40.152Z" }, + { url = "https://files.pythonhosted.org/packages/7a/58/afd56de246cf11780a40a2c28dc7cbabbf06337cc8ddb1c780a2d97e88d8/frozenlist-1.8.0-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:db1e72ede2d0d7ccb213f218df6a078a9c09a7de257c2fe8fcef16d5925230b1", size = 237763, upload-time = "2025-10-06T05:36:41.355Z" }, + { url = "https://files.pythonhosted.org/packages/cb/36/cdfaf6ed42e2644740d4a10452d8e97fa1c062e2a8006e4b09f1b5fd7d63/frozenlist-1.8.0-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:b4dec9482a65c54a5044486847b8a66bf10c9cb4926d42927ec4e8fd5db7fed8", size = 240110, upload-time = "2025-10-06T05:36:42.716Z" }, + { url = "https://files.pythonhosted.org/packages/03/a8/9ea226fbefad669f11b52e864c55f0bd57d3c8d7eb07e9f2e9a0b39502e1/frozenlist-1.8.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:21900c48ae04d13d416f0e1e0c4d81f7931f73a9dfa0b7a8746fb2fe7dd970ed", size = 233717, upload-time = "2025-10-06T05:36:44.251Z" }, + { url = "https://files.pythonhosted.org/packages/1e/0b/1b5531611e83ba7d13ccc9988967ea1b51186af64c42b7a7af465dcc9568/frozenlist-1.8.0-cp313-cp313-win32.whl", hash = "sha256:8b7b94a067d1c504ee0b16def57ad5738701e4ba10cec90529f13fa03c833496", size = 39628, upload-time = "2025-10-06T05:36:45.423Z" }, + { url = "https://files.pythonhosted.org/packages/d8/cf/174c91dbc9cc49bc7b7aab74d8b734e974d1faa8f191c74af9b7e80848e6/frozenlist-1.8.0-cp313-cp313-win_amd64.whl", hash = "sha256:878be833caa6a3821caf85eb39c5ba92d28e85df26d57afb06b35b2efd937231", size = 43882, upload-time = "2025-10-06T05:36:46.796Z" }, + { url = "https://files.pythonhosted.org/packages/c1/17/502cd212cbfa96eb1388614fe39a3fc9ab87dbbe042b66f97acb57474834/frozenlist-1.8.0-cp313-cp313-win_arm64.whl", hash = "sha256:44389d135b3ff43ba8cc89ff7f51f5a0bb6b63d829c8300f79a2fe4fe61bcc62", size = 39676, upload-time = "2025-10-06T05:36:47.8Z" }, + { url = "https://files.pythonhosted.org/packages/d2/5c/3bbfaa920dfab09e76946a5d2833a7cbdf7b9b4a91c714666ac4855b88b4/frozenlist-1.8.0-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:e25ac20a2ef37e91c1b39938b591457666a0fa835c7783c3a8f33ea42870db94", size = 89235, upload-time = "2025-10-06T05:36:48.78Z" }, + { url = "https://files.pythonhosted.org/packages/d2/d6/f03961ef72166cec1687e84e8925838442b615bd0b8854b54923ce5b7b8a/frozenlist-1.8.0-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:07cdca25a91a4386d2e76ad992916a85038a9b97561bf7a3fd12d5d9ce31870c", size = 50742, upload-time = "2025-10-06T05:36:49.837Z" }, + { url = "https://files.pythonhosted.org/packages/1e/bb/a6d12b7ba4c3337667d0e421f7181c82dda448ce4e7ad7ecd249a16fa806/frozenlist-1.8.0-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:4e0c11f2cc6717e0a741f84a527c52616140741cd812a50422f83dc31749fb52", size = 51725, upload-time = "2025-10-06T05:36:50.851Z" }, + { url = "https://files.pythonhosted.org/packages/bc/71/d1fed0ffe2c2ccd70b43714c6cab0f4188f09f8a67a7914a6b46ee30f274/frozenlist-1.8.0-cp313-cp313t-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:b3210649ee28062ea6099cfda39e147fa1bc039583c8ee4481cb7811e2448c51", size = 284533, upload-time = "2025-10-06T05:36:51.898Z" }, + { url = "https://files.pythonhosted.org/packages/c9/1f/fb1685a7b009d89f9bf78a42d94461bc06581f6e718c39344754a5d9bada/frozenlist-1.8.0-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:581ef5194c48035a7de2aefc72ac6539823bb71508189e5de01d60c9dcd5fa65", size = 292506, upload-time = "2025-10-06T05:36:53.101Z" }, + { url = "https://files.pythonhosted.org/packages/e6/3b/b991fe1612703f7e0d05c0cf734c1b77aaf7c7d321df4572e8d36e7048c8/frozenlist-1.8.0-cp313-cp313t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:3ef2d026f16a2b1866e1d86fc4e1291e1ed8a387b2c333809419a2f8b3a77b82", size = 274161, upload-time = "2025-10-06T05:36:54.309Z" }, + { url = "https://files.pythonhosted.org/packages/ca/ec/c5c618767bcdf66e88945ec0157d7f6c4a1322f1473392319b7a2501ded7/frozenlist-1.8.0-cp313-cp313t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:5500ef82073f599ac84d888e3a8c1f77ac831183244bfd7f11eaa0289fb30714", size = 294676, upload-time = "2025-10-06T05:36:55.566Z" }, + { url = "https://files.pythonhosted.org/packages/7c/ce/3934758637d8f8a88d11f0585d6495ef54b2044ed6ec84492a91fa3b27aa/frozenlist-1.8.0-cp313-cp313t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:50066c3997d0091c411a66e710f4e11752251e6d2d73d70d8d5d4c76442a199d", size = 300638, upload-time = "2025-10-06T05:36:56.758Z" }, + { url = "https://files.pythonhosted.org/packages/fc/4f/a7e4d0d467298f42de4b41cbc7ddaf19d3cfeabaf9ff97c20c6c7ee409f9/frozenlist-1.8.0-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:5c1c8e78426e59b3f8005e9b19f6ff46e5845895adbde20ece9218319eca6506", size = 283067, upload-time = "2025-10-06T05:36:57.965Z" }, + { url = "https://files.pythonhosted.org/packages/dc/48/c7b163063d55a83772b268e6d1affb960771b0e203b632cfe09522d67ea5/frozenlist-1.8.0-cp313-cp313t-musllinux_1_2_armv7l.whl", hash = "sha256:eefdba20de0d938cec6a89bd4d70f346a03108a19b9df4248d3cf0d88f1b0f51", size = 292101, upload-time = "2025-10-06T05:36:59.237Z" }, + { url = "https://files.pythonhosted.org/packages/9f/d0/2366d3c4ecdc2fd391e0afa6e11500bfba0ea772764d631bbf82f0136c9d/frozenlist-1.8.0-cp313-cp313t-musllinux_1_2_ppc64le.whl", hash = "sha256:cf253e0e1c3ceb4aaff6df637ce033ff6535fb8c70a764a8f46aafd3d6ab798e", size = 289901, upload-time = "2025-10-06T05:37:00.811Z" }, + { url = "https://files.pythonhosted.org/packages/b8/94/daff920e82c1b70e3618a2ac39fbc01ae3e2ff6124e80739ce5d71c9b920/frozenlist-1.8.0-cp313-cp313t-musllinux_1_2_s390x.whl", hash = "sha256:032efa2674356903cd0261c4317a561a6850f3ac864a63fc1583147fb05a79b0", size = 289395, upload-time = "2025-10-06T05:37:02.115Z" }, + { url = "https://files.pythonhosted.org/packages/e3/20/bba307ab4235a09fdcd3cc5508dbabd17c4634a1af4b96e0f69bfe551ebd/frozenlist-1.8.0-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:6da155091429aeba16851ecb10a9104a108bcd32f6c1642867eadaee401c1c41", size = 283659, upload-time = "2025-10-06T05:37:03.711Z" }, + { url = "https://files.pythonhosted.org/packages/fd/00/04ca1c3a7a124b6de4f8a9a17cc2fcad138b4608e7a3fc5877804b8715d7/frozenlist-1.8.0-cp313-cp313t-win32.whl", hash = "sha256:0f96534f8bfebc1a394209427d0f8a63d343c9779cda6fc25e8e121b5fd8555b", size = 43492, upload-time = "2025-10-06T05:37:04.915Z" }, + { url = "https://files.pythonhosted.org/packages/59/5e/c69f733a86a94ab10f68e496dc6b7e8bc078ebb415281d5698313e3af3a1/frozenlist-1.8.0-cp313-cp313t-win_amd64.whl", hash = "sha256:5d63a068f978fc69421fb0e6eb91a9603187527c86b7cd3f534a5b77a592b888", size = 48034, upload-time = "2025-10-06T05:37:06.343Z" }, + { url = "https://files.pythonhosted.org/packages/16/6c/be9d79775d8abe79b05fa6d23da99ad6e7763a1d080fbae7290b286093fd/frozenlist-1.8.0-cp313-cp313t-win_arm64.whl", hash = "sha256:bf0a7e10b077bf5fb9380ad3ae8ce20ef919a6ad93b4552896419ac7e1d8e042", size = 41749, upload-time = "2025-10-06T05:37:07.431Z" }, + { url = "https://files.pythonhosted.org/packages/f1/c8/85da824b7e7b9b6e7f7705b2ecaf9591ba6f79c1177f324c2735e41d36a2/frozenlist-1.8.0-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:cee686f1f4cadeb2136007ddedd0aaf928ab95216e7691c63e50a8ec066336d0", size = 86127, upload-time = "2025-10-06T05:37:08.438Z" }, + { url = "https://files.pythonhosted.org/packages/8e/e8/a1185e236ec66c20afd72399522f142c3724c785789255202d27ae992818/frozenlist-1.8.0-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:119fb2a1bd47307e899c2fac7f28e85b9a543864df47aa7ec9d3c1b4545f096f", size = 49698, upload-time = "2025-10-06T05:37:09.48Z" }, + { url = "https://files.pythonhosted.org/packages/a1/93/72b1736d68f03fda5fdf0f2180fb6caaae3894f1b854d006ac61ecc727ee/frozenlist-1.8.0-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:4970ece02dbc8c3a92fcc5228e36a3e933a01a999f7094ff7c23fbd2beeaa67c", size = 49749, upload-time = "2025-10-06T05:37:10.569Z" }, + { url = "https://files.pythonhosted.org/packages/a7/b2/fabede9fafd976b991e9f1b9c8c873ed86f202889b864756f240ce6dd855/frozenlist-1.8.0-cp314-cp314-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:cba69cb73723c3f329622e34bdbf5ce1f80c21c290ff04256cff1cd3c2036ed2", size = 231298, upload-time = "2025-10-06T05:37:11.993Z" }, + { url = "https://files.pythonhosted.org/packages/3a/3b/d9b1e0b0eed36e70477ffb8360c49c85c8ca8ef9700a4e6711f39a6e8b45/frozenlist-1.8.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:778a11b15673f6f1df23d9586f83c4846c471a8af693a22e066508b77d201ec8", size = 232015, upload-time = "2025-10-06T05:37:13.194Z" }, + { url = "https://files.pythonhosted.org/packages/dc/94/be719d2766c1138148564a3960fc2c06eb688da592bdc25adcf856101be7/frozenlist-1.8.0-cp314-cp314-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:0325024fe97f94c41c08872db482cf8ac4800d80e79222c6b0b7b162d5b13686", size = 225038, upload-time = "2025-10-06T05:37:14.577Z" }, + { url = "https://files.pythonhosted.org/packages/e4/09/6712b6c5465f083f52f50cf74167b92d4ea2f50e46a9eea0523d658454ae/frozenlist-1.8.0-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:97260ff46b207a82a7567b581ab4190bd4dfa09f4db8a8b49d1a958f6aa4940e", size = 240130, upload-time = "2025-10-06T05:37:15.781Z" }, + { url = "https://files.pythonhosted.org/packages/f8/d4/cd065cdcf21550b54f3ce6a22e143ac9e4836ca42a0de1022da8498eac89/frozenlist-1.8.0-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:54b2077180eb7f83dd52c40b2750d0a9f175e06a42e3213ce047219de902717a", size = 242845, upload-time = "2025-10-06T05:37:17.037Z" }, + { url = "https://files.pythonhosted.org/packages/62/c3/f57a5c8c70cd1ead3d5d5f776f89d33110b1addae0ab010ad774d9a44fb9/frozenlist-1.8.0-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:2f05983daecab868a31e1da44462873306d3cbfd76d1f0b5b69c473d21dbb128", size = 229131, upload-time = "2025-10-06T05:37:18.221Z" }, + { url = "https://files.pythonhosted.org/packages/6c/52/232476fe9cb64f0742f3fde2b7d26c1dac18b6d62071c74d4ded55e0ef94/frozenlist-1.8.0-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:33f48f51a446114bc5d251fb2954ab0164d5be02ad3382abcbfe07e2531d650f", size = 240542, upload-time = "2025-10-06T05:37:19.771Z" }, + { url = "https://files.pythonhosted.org/packages/5f/85/07bf3f5d0fb5414aee5f47d33c6f5c77bfe49aac680bfece33d4fdf6a246/frozenlist-1.8.0-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:154e55ec0655291b5dd1b8731c637ecdb50975a2ae70c606d100750a540082f7", size = 237308, upload-time = "2025-10-06T05:37:20.969Z" }, + { url = "https://files.pythonhosted.org/packages/11/99/ae3a33d5befd41ac0ca2cc7fd3aa707c9c324de2e89db0e0f45db9a64c26/frozenlist-1.8.0-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:4314debad13beb564b708b4a496020e5306c7333fa9a3ab90374169a20ffab30", size = 238210, upload-time = "2025-10-06T05:37:22.252Z" }, + { url = "https://files.pythonhosted.org/packages/b2/60/b1d2da22f4970e7a155f0adde9b1435712ece01b3cd45ba63702aea33938/frozenlist-1.8.0-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:073f8bf8becba60aa931eb3bc420b217bb7d5b8f4750e6f8b3be7f3da85d38b7", size = 231972, upload-time = "2025-10-06T05:37:23.5Z" }, + { url = "https://files.pythonhosted.org/packages/3f/ab/945b2f32de889993b9c9133216c068b7fcf257d8595a0ac420ac8677cab0/frozenlist-1.8.0-cp314-cp314-win32.whl", hash = "sha256:bac9c42ba2ac65ddc115d930c78d24ab8d4f465fd3fc473cdedfccadb9429806", size = 40536, upload-time = "2025-10-06T05:37:25.581Z" }, + { url = "https://files.pythonhosted.org/packages/59/ad/9caa9b9c836d9ad6f067157a531ac48b7d36499f5036d4141ce78c230b1b/frozenlist-1.8.0-cp314-cp314-win_amd64.whl", hash = "sha256:3e0761f4d1a44f1d1a47996511752cf3dcec5bbdd9cc2b4fe595caf97754b7a0", size = 44330, upload-time = "2025-10-06T05:37:26.928Z" }, + { url = "https://files.pythonhosted.org/packages/82/13/e6950121764f2676f43534c555249f57030150260aee9dcf7d64efda11dd/frozenlist-1.8.0-cp314-cp314-win_arm64.whl", hash = "sha256:d1eaff1d00c7751b7c6662e9c5ba6eb2c17a2306ba5e2a37f24ddf3cc953402b", size = 40627, upload-time = "2025-10-06T05:37:28.075Z" }, + { url = "https://files.pythonhosted.org/packages/c0/c7/43200656ecc4e02d3f8bc248df68256cd9572b3f0017f0a0c4e93440ae23/frozenlist-1.8.0-cp314-cp314t-macosx_10_13_universal2.whl", hash = "sha256:d3bb933317c52d7ea5004a1c442eef86f426886fba134ef8cf4226ea6ee1821d", size = 89238, upload-time = "2025-10-06T05:37:29.373Z" }, + { url = "https://files.pythonhosted.org/packages/d1/29/55c5f0689b9c0fb765055629f472c0de484dcaf0acee2f7707266ae3583c/frozenlist-1.8.0-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:8009897cdef112072f93a0efdce29cd819e717fd2f649ee3016efd3cd885a7ed", size = 50738, upload-time = "2025-10-06T05:37:30.792Z" }, + { url = "https://files.pythonhosted.org/packages/ba/7d/b7282a445956506fa11da8c2db7d276adcbf2b17d8bb8407a47685263f90/frozenlist-1.8.0-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:2c5dcbbc55383e5883246d11fd179782a9d07a986c40f49abe89ddf865913930", size = 51739, upload-time = "2025-10-06T05:37:32.127Z" }, + { url = "https://files.pythonhosted.org/packages/62/1c/3d8622e60d0b767a5510d1d3cf21065b9db874696a51ea6d7a43180a259c/frozenlist-1.8.0-cp314-cp314t-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:39ecbc32f1390387d2aa4f5a995e465e9e2f79ba3adcac92d68e3e0afae6657c", size = 284186, upload-time = "2025-10-06T05:37:33.21Z" }, + { url = "https://files.pythonhosted.org/packages/2d/14/aa36d5f85a89679a85a1d44cd7a6657e0b1c75f61e7cad987b203d2daca8/frozenlist-1.8.0-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:92db2bf818d5cc8d9c1f1fc56b897662e24ea5adb36ad1f1d82875bd64e03c24", size = 292196, upload-time = "2025-10-06T05:37:36.107Z" }, + { url = "https://files.pythonhosted.org/packages/05/23/6bde59eb55abd407d34f77d39a5126fb7b4f109a3f611d3929f14b700c66/frozenlist-1.8.0-cp314-cp314t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:2dc43a022e555de94c3b68a4ef0b11c4f747d12c024a520c7101709a2144fb37", size = 273830, upload-time = "2025-10-06T05:37:37.663Z" }, + { url = "https://files.pythonhosted.org/packages/d2/3f/22cff331bfad7a8afa616289000ba793347fcd7bc275f3b28ecea2a27909/frozenlist-1.8.0-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:cb89a7f2de3602cfed448095bab3f178399646ab7c61454315089787df07733a", size = 294289, upload-time = "2025-10-06T05:37:39.261Z" }, + { url = "https://files.pythonhosted.org/packages/a4/89/5b057c799de4838b6c69aa82b79705f2027615e01be996d2486a69ca99c4/frozenlist-1.8.0-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:33139dc858c580ea50e7e60a1b0ea003efa1fd42e6ec7fdbad78fff65fad2fd2", size = 300318, upload-time = "2025-10-06T05:37:43.213Z" }, + { url = "https://files.pythonhosted.org/packages/30/de/2c22ab3eb2a8af6d69dc799e48455813bab3690c760de58e1bf43b36da3e/frozenlist-1.8.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:168c0969a329b416119507ba30b9ea13688fafffac1b7822802537569a1cb0ef", size = 282814, upload-time = "2025-10-06T05:37:45.337Z" }, + { url = "https://files.pythonhosted.org/packages/59/f7/970141a6a8dbd7f556d94977858cfb36fa9b66e0892c6dd780d2219d8cd8/frozenlist-1.8.0-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:28bd570e8e189d7f7b001966435f9dac6718324b5be2990ac496cf1ea9ddb7fe", size = 291762, upload-time = "2025-10-06T05:37:46.657Z" }, + { url = "https://files.pythonhosted.org/packages/c1/15/ca1adae83a719f82df9116d66f5bb28bb95557b3951903d39135620ef157/frozenlist-1.8.0-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:b2a095d45c5d46e5e79ba1e5b9cb787f541a8dee0433836cea4b96a2c439dcd8", size = 289470, upload-time = "2025-10-06T05:37:47.946Z" }, + { url = "https://files.pythonhosted.org/packages/ac/83/dca6dc53bf657d371fbc88ddeb21b79891e747189c5de990b9dfff2ccba1/frozenlist-1.8.0-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:eab8145831a0d56ec9c4139b6c3e594c7a83c2c8be25d5bcf2d86136a532287a", size = 289042, upload-time = "2025-10-06T05:37:49.499Z" }, + { url = "https://files.pythonhosted.org/packages/96/52/abddd34ca99be142f354398700536c5bd315880ed0a213812bc491cff5e4/frozenlist-1.8.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:974b28cf63cc99dfb2188d8d222bc6843656188164848c4f679e63dae4b0708e", size = 283148, upload-time = "2025-10-06T05:37:50.745Z" }, + { url = "https://files.pythonhosted.org/packages/af/d3/76bd4ed4317e7119c2b7f57c3f6934aba26d277acc6309f873341640e21f/frozenlist-1.8.0-cp314-cp314t-win32.whl", hash = "sha256:342c97bf697ac5480c0a7ec73cd700ecfa5a8a40ac923bd035484616efecc2df", size = 44676, upload-time = "2025-10-06T05:37:52.222Z" }, + { url = "https://files.pythonhosted.org/packages/89/76/c615883b7b521ead2944bb3480398cbb07e12b7b4e4d073d3752eb721558/frozenlist-1.8.0-cp314-cp314t-win_amd64.whl", hash = "sha256:06be8f67f39c8b1dc671f5d83aaefd3358ae5cdcf8314552c57e7ed3e6475bdd", size = 49451, upload-time = "2025-10-06T05:37:53.425Z" }, + { url = "https://files.pythonhosted.org/packages/e0/a3/5982da14e113d07b325230f95060e2169f5311b1017ea8af2a29b374c289/frozenlist-1.8.0-cp314-cp314t-win_arm64.whl", hash = "sha256:102e6314ca4da683dca92e3b1355490fed5f313b768500084fbe6371fddfdb79", size = 42507, upload-time = "2025-10-06T05:37:54.513Z" }, + { url = "https://files.pythonhosted.org/packages/9a/9a/e35b4a917281c0b8419d4207f4334c8e8c5dbf4f3f5f9ada73958d937dcc/frozenlist-1.8.0-py3-none-any.whl", hash = "sha256:0c18a16eab41e82c295618a77502e17b195883241c563b00f0aa5106fc4eaa0d", size = 13409, upload-time = "2025-10-06T05:38:16.721Z" }, +] + +[[package]] +name = "fsspec" +version = "2026.2.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/51/7c/f60c259dcbf4f0c47cc4ddb8f7720d2dcdc8888c8e5ad84c73ea4531cc5b/fsspec-2026.2.0.tar.gz", hash = "sha256:6544e34b16869f5aacd5b90bdf1a71acb37792ea3ddf6125ee69a22a53fb8bff", size = 313441, upload-time = "2026-02-05T21:50:53.743Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e6/ab/fb21f4c939bb440104cc2b396d3be1d9b7a9fd3c6c2a53d98c45b3d7c954/fsspec-2026.2.0-py3-none-any.whl", hash = "sha256:98de475b5cb3bd66bedd5c4679e87b4fdfe1a3bf4d707b151b3c07e58c9a2437", size = 202505, upload-time = "2026-02-05T21:50:51.819Z" }, +] + +[[package]] +name = "greenlet" +version = "3.3.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/8a/99/1cd3411c56a410994669062bd73dd58270c00cc074cac15f385a1fd91f8a/greenlet-3.3.1.tar.gz", hash = "sha256:41848f3230b58c08bb43dee542e74a2a2e34d3c59dc3076cec9151aeeedcae98", size = 184690, upload-time = "2026-01-23T15:31:02.076Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ec/e8/2e1462c8fdbe0f210feb5ac7ad2d9029af8be3bf45bd9fa39765f821642f/greenlet-3.3.1-cp311-cp311-macosx_11_0_universal2.whl", hash = "sha256:5fd23b9bc6d37b563211c6abbb1b3cab27db385a4449af5c32e932f93017080c", size = 274974, upload-time = "2026-01-23T15:31:02.891Z" }, + { url = "https://files.pythonhosted.org/packages/7e/a8/530a401419a6b302af59f67aaf0b9ba1015855ea7e56c036b5928793c5bd/greenlet-3.3.1-cp311-cp311-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:09f51496a0bfbaa9d74d36a52d2580d1ef5ed4fdfcff0a73730abfbbbe1403dd", size = 577175, upload-time = "2026-01-23T16:00:56.213Z" }, + { url = "https://files.pythonhosted.org/packages/8e/89/7e812bb9c05e1aaef9b597ac1d0962b9021d2c6269354966451e885c4e6b/greenlet-3.3.1-cp311-cp311-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:cb0feb07fe6e6a74615ee62a880007d976cf739b6669cce95daa7373d4fc69c5", size = 590401, upload-time = "2026-01-23T16:05:26.365Z" }, + { url = "https://files.pythonhosted.org/packages/70/ae/e2d5f0e59b94a2269b68a629173263fa40b63da32f5c231307c349315871/greenlet-3.3.1-cp311-cp311-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:67ea3fc73c8cd92f42467a72b75e8f05ed51a0e9b1d15398c913416f2dafd49f", size = 601161, upload-time = "2026-01-23T16:15:53.456Z" }, + { url = "https://files.pythonhosted.org/packages/5c/ae/8d472e1f5ac5efe55c563f3eabb38c98a44b832602e12910750a7c025802/greenlet-3.3.1-cp311-cp311-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:39eda9ba259cc9801da05351eaa8576e9aa83eb9411e8f0c299e05d712a210f2", size = 590272, upload-time = "2026-01-23T15:32:49.411Z" }, + { url = "https://files.pythonhosted.org/packages/a8/51/0fde34bebfcadc833550717eade64e35ec8738e6b097d5d248274a01258b/greenlet-3.3.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:e2e7e882f83149f0a71ac822ebf156d902e7a5d22c9045e3e0d1daf59cee2cc9", size = 1550729, upload-time = "2026-01-23T16:04:20.867Z" }, + { url = "https://files.pythonhosted.org/packages/16/c9/2fb47bee83b25b119d5a35d580807bb8b92480a54b68fef009a02945629f/greenlet-3.3.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:80aa4d79eb5564f2e0a6144fcc744b5a37c56c4a92d60920720e99210d88db0f", size = 1615552, upload-time = "2026-01-23T15:33:45.743Z" }, + { url = "https://files.pythonhosted.org/packages/1f/54/dcf9f737b96606f82f8dd05becfb8d238db0633dd7397d542a296fe9cad3/greenlet-3.3.1-cp311-cp311-win_amd64.whl", hash = "sha256:32e4ca9777c5addcbf42ff3915d99030d8e00173a56f80001fb3875998fe410b", size = 226462, upload-time = "2026-01-23T15:36:50.422Z" }, + { url = "https://files.pythonhosted.org/packages/91/37/61e1015cf944ddd2337447d8e97fb423ac9bc21f9963fb5f206b53d65649/greenlet-3.3.1-cp311-cp311-win_arm64.whl", hash = "sha256:da19609432f353fed186cc1b85e9440db93d489f198b4bdf42ae19cc9d9ac9b4", size = 225715, upload-time = "2026-01-23T15:33:17.298Z" }, + { url = "https://files.pythonhosted.org/packages/f9/c8/9d76a66421d1ae24340dfae7e79c313957f6e3195c144d2c73333b5bfe34/greenlet-3.3.1-cp312-cp312-macosx_11_0_universal2.whl", hash = "sha256:7e806ca53acf6d15a888405880766ec84721aa4181261cd11a457dfe9a7a4975", size = 276443, upload-time = "2026-01-23T15:30:10.066Z" }, + { url = "https://files.pythonhosted.org/packages/81/99/401ff34bb3c032d1f10477d199724f5e5f6fbfb59816ad1455c79c1eb8e7/greenlet-3.3.1-cp312-cp312-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d842c94b9155f1c9b3058036c24ffb8ff78b428414a19792b2380be9cecf4f36", size = 597359, upload-time = "2026-01-23T16:00:57.394Z" }, + { url = "https://files.pythonhosted.org/packages/2b/bc/4dcc0871ed557792d304f50be0f7487a14e017952ec689effe2180a6ff35/greenlet-3.3.1-cp312-cp312-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:20fedaadd422fa02695f82093f9a98bad3dab5fcda793c658b945fcde2ab27ba", size = 607805, upload-time = "2026-01-23T16:05:28.068Z" }, + { url = "https://files.pythonhosted.org/packages/3b/cd/7a7ca57588dac3389e97f7c9521cb6641fd8b6602faf1eaa4188384757df/greenlet-3.3.1-cp312-cp312-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:c620051669fd04ac6b60ebc70478210119c56e2d5d5df848baec4312e260e4ca", size = 622363, upload-time = "2026-01-23T16:15:54.754Z" }, + { url = "https://files.pythonhosted.org/packages/cf/05/821587cf19e2ce1f2b24945d890b164401e5085f9d09cbd969b0c193cd20/greenlet-3.3.1-cp312-cp312-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:14194f5f4305800ff329cbf02c5fcc88f01886cadd29941b807668a45f0d2336", size = 609947, upload-time = "2026-01-23T15:32:51.004Z" }, + { url = "https://files.pythonhosted.org/packages/a4/52/ee8c46ed9f8babaa93a19e577f26e3d28a519feac6350ed6f25f1afee7e9/greenlet-3.3.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:7b2fe4150a0cf59f847a67db8c155ac36aed89080a6a639e9f16df5d6c6096f1", size = 1567487, upload-time = "2026-01-23T16:04:22.125Z" }, + { url = "https://files.pythonhosted.org/packages/8f/7c/456a74f07029597626f3a6db71b273a3632aecb9afafeeca452cfa633197/greenlet-3.3.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:49f4ad195d45f4a66a0eb9c1ba4832bb380570d361912fa3554746830d332149", size = 1636087, upload-time = "2026-01-23T15:33:47.486Z" }, + { url = "https://files.pythonhosted.org/packages/34/2f/5e0e41f33c69655300a5e54aeb637cf8ff57f1786a3aba374eacc0228c1d/greenlet-3.3.1-cp312-cp312-win_amd64.whl", hash = "sha256:cc98b9c4e4870fa983436afa999d4eb16b12872fab7071423d5262fa7120d57a", size = 227156, upload-time = "2026-01-23T15:34:34.808Z" }, + { url = "https://files.pythonhosted.org/packages/c8/ab/717c58343cf02c5265b531384b248787e04d8160b8afe53d9eec053d7b44/greenlet-3.3.1-cp312-cp312-win_arm64.whl", hash = "sha256:bfb2d1763d777de5ee495c85309460f6fd8146e50ec9d0ae0183dbf6f0a829d1", size = 226403, upload-time = "2026-01-23T15:31:39.372Z" }, + { url = "https://files.pythonhosted.org/packages/ec/ab/d26750f2b7242c2b90ea2ad71de70cfcd73a948a49513188a0fc0d6fc15a/greenlet-3.3.1-cp313-cp313-macosx_11_0_universal2.whl", hash = "sha256:7ab327905cabb0622adca5971e488064e35115430cec2c35a50fd36e72a315b3", size = 275205, upload-time = "2026-01-23T15:30:24.556Z" }, + { url = "https://files.pythonhosted.org/packages/10/d3/be7d19e8fad7c5a78eeefb2d896a08cd4643e1e90c605c4be3b46264998f/greenlet-3.3.1-cp313-cp313-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:65be2f026ca6a176f88fb935ee23c18333ccea97048076aef4db1ef5bc0713ac", size = 599284, upload-time = "2026-01-23T16:00:58.584Z" }, + { url = "https://files.pythonhosted.org/packages/ae/21/fe703aaa056fdb0f17e5afd4b5c80195bbdab701208918938bd15b00d39b/greenlet-3.3.1-cp313-cp313-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:7a3ae05b3d225b4155bda56b072ceb09d05e974bc74be6c3fc15463cf69f33fd", size = 610274, upload-time = "2026-01-23T16:05:29.312Z" }, + { url = "https://files.pythonhosted.org/packages/06/00/95df0b6a935103c0452dad2203f5be8377e551b8466a29650c4c5a5af6cc/greenlet-3.3.1-cp313-cp313-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:12184c61e5d64268a160226fb4818af4df02cfead8379d7f8b99a56c3a54ff3e", size = 624375, upload-time = "2026-01-23T16:15:55.915Z" }, + { url = "https://files.pythonhosted.org/packages/cb/86/5c6ab23bb3c28c21ed6bebad006515cfe08b04613eb105ca0041fecca852/greenlet-3.3.1-cp313-cp313-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6423481193bbbe871313de5fd06a082f2649e7ce6e08015d2a76c1e9186ca5b3", size = 612904, upload-time = "2026-01-23T15:32:52.317Z" }, + { url = "https://files.pythonhosted.org/packages/c2/f3/7949994264e22639e40718c2daf6f6df5169bf48fb038c008a489ec53a50/greenlet-3.3.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:33a956fe78bbbda82bfc95e128d61129b32d66bcf0a20a1f0c08aa4839ffa951", size = 1567316, upload-time = "2026-01-23T16:04:23.316Z" }, + { url = "https://files.pythonhosted.org/packages/8d/6e/d73c94d13b6465e9f7cd6231c68abde838bb22408596c05d9059830b7872/greenlet-3.3.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:4b065d3284be43728dd280f6f9a13990b56470b81be20375a207cdc814a983f2", size = 1636549, upload-time = "2026-01-23T15:33:48.643Z" }, + { url = "https://files.pythonhosted.org/packages/5e/b3/c9c23a6478b3bcc91f979ce4ca50879e4d0b2bd7b9a53d8ecded719b92e2/greenlet-3.3.1-cp313-cp313-win_amd64.whl", hash = "sha256:27289986f4e5b0edec7b5a91063c109f0276abb09a7e9bdab08437525977c946", size = 227042, upload-time = "2026-01-23T15:33:58.216Z" }, + { url = "https://files.pythonhosted.org/packages/90/e7/824beda656097edee36ab15809fd063447b200cc03a7f6a24c34d520bc88/greenlet-3.3.1-cp313-cp313-win_arm64.whl", hash = "sha256:2f080e028001c5273e0b42690eaf359aeef9cb1389da0f171ea51a5dc3c7608d", size = 226294, upload-time = "2026-01-23T15:30:52.73Z" }, + { url = "https://files.pythonhosted.org/packages/ae/fb/011c7c717213182caf78084a9bea51c8590b0afda98001f69d9f853a495b/greenlet-3.3.1-cp314-cp314-macosx_11_0_universal2.whl", hash = "sha256:bd59acd8529b372775cd0fcbc5f420ae20681c5b045ce25bd453ed8455ab99b5", size = 275737, upload-time = "2026-01-23T15:32:16.889Z" }, + { url = "https://files.pythonhosted.org/packages/41/2e/a3a417d620363fdbb08a48b1dd582956a46a61bf8fd27ee8164f9dfe87c2/greenlet-3.3.1-cp314-cp314-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b31c05dd84ef6871dd47120386aed35323c944d86c3d91a17c4b8d23df62f15b", size = 646422, upload-time = "2026-01-23T16:01:00.354Z" }, + { url = "https://files.pythonhosted.org/packages/b4/09/c6c4a0db47defafd2d6bab8ddfe47ad19963b4e30f5bed84d75328059f8c/greenlet-3.3.1-cp314-cp314-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:02925a0bfffc41e542c70aa14c7eda3593e4d7e274bfcccca1827e6c0875902e", size = 658219, upload-time = "2026-01-23T16:05:30.956Z" }, + { url = "https://files.pythonhosted.org/packages/e2/89/b95f2ddcc5f3c2bc09c8ee8d77be312df7f9e7175703ab780f2014a0e781/greenlet-3.3.1-cp314-cp314-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:3e0f3878ca3a3ff63ab4ea478585942b53df66ddde327b59ecb191b19dbbd62d", size = 671455, upload-time = "2026-01-23T16:15:57.232Z" }, + { url = "https://files.pythonhosted.org/packages/80/38/9d42d60dffb04b45f03dbab9430898352dba277758640751dc5cc316c521/greenlet-3.3.1-cp314-cp314-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:34a729e2e4e4ffe9ae2408d5ecaf12f944853f40ad724929b7585bca808a9d6f", size = 660237, upload-time = "2026-01-23T15:32:53.967Z" }, + { url = "https://files.pythonhosted.org/packages/96/61/373c30b7197f9e756e4c81ae90a8d55dc3598c17673f91f4d31c3c689c3f/greenlet-3.3.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:aec9ab04e82918e623415947921dea15851b152b822661cce3f8e4393c3df683", size = 1615261, upload-time = "2026-01-23T16:04:25.066Z" }, + { url = "https://files.pythonhosted.org/packages/fd/d3/ca534310343f5945316f9451e953dcd89b36fe7a19de652a1dc5a0eeef3f/greenlet-3.3.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:71c767cf281a80d02b6c1bdc41c9468e1f5a494fb11bc8688c360524e273d7b1", size = 1683719, upload-time = "2026-01-23T15:33:50.61Z" }, + { url = "https://files.pythonhosted.org/packages/52/cb/c21a3fd5d2c9c8b622e7bede6d6d00e00551a5ee474ea6d831b5f567a8b4/greenlet-3.3.1-cp314-cp314-win_amd64.whl", hash = "sha256:96aff77af063b607f2489473484e39a0bbae730f2ea90c9e5606c9b73c44174a", size = 228125, upload-time = "2026-01-23T15:32:45.265Z" }, + { url = "https://files.pythonhosted.org/packages/6a/8e/8a2db6d11491837af1de64b8aff23707c6e85241be13c60ed399a72e2ef8/greenlet-3.3.1-cp314-cp314-win_arm64.whl", hash = "sha256:b066e8b50e28b503f604fa538adc764a638b38cf8e81e025011d26e8a627fa79", size = 227519, upload-time = "2026-01-23T15:31:47.284Z" }, + { url = "https://files.pythonhosted.org/packages/28/24/cbbec49bacdcc9ec652a81d3efef7b59f326697e7edf6ed775a5e08e54c2/greenlet-3.3.1-cp314-cp314t-macosx_11_0_universal2.whl", hash = "sha256:3e63252943c921b90abb035ebe9de832c436401d9c45f262d80e2d06cc659242", size = 282706, upload-time = "2026-01-23T15:33:05.525Z" }, + { url = "https://files.pythonhosted.org/packages/86/2e/4f2b9323c144c4fe8842a4e0d92121465485c3c2c5b9e9b30a52e80f523f/greenlet-3.3.1-cp314-cp314t-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:76e39058e68eb125de10c92524573924e827927df5d3891fbc97bd55764a8774", size = 651209, upload-time = "2026-01-23T16:01:01.517Z" }, + { url = "https://files.pythonhosted.org/packages/d9/87/50ca60e515f5bb55a2fbc5f0c9b5b156de7d2fc51a0a69abc9d23914a237/greenlet-3.3.1-cp314-cp314t-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:c9f9d5e7a9310b7a2f416dd13d2e3fd8b42d803968ea580b7c0f322ccb389b97", size = 654300, upload-time = "2026-01-23T16:05:32.199Z" }, + { url = "https://files.pythonhosted.org/packages/7c/25/c51a63f3f463171e09cb586eb64db0861eb06667ab01a7968371a24c4f3b/greenlet-3.3.1-cp314-cp314t-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:4b9721549a95db96689458a1e0ae32412ca18776ed004463df3a9299c1b257ab", size = 662574, upload-time = "2026-01-23T16:15:58.364Z" }, + { url = "https://files.pythonhosted.org/packages/1d/94/74310866dfa2b73dd08659a3d18762f83985ad3281901ba0ee9a815194fb/greenlet-3.3.1-cp314-cp314t-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:92497c78adf3ac703b57f1e3813c2d874f27f71a178f9ea5887855da413cd6d2", size = 653842, upload-time = "2026-01-23T15:32:55.671Z" }, + { url = "https://files.pythonhosted.org/packages/97/43/8bf0ffa3d498eeee4c58c212a3905dd6146c01c8dc0b0a046481ca29b18c/greenlet-3.3.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:ed6b402bc74d6557a705e197d47f9063733091ed6357b3de33619d8a8d93ac53", size = 1614917, upload-time = "2026-01-23T16:04:26.276Z" }, + { url = "https://files.pythonhosted.org/packages/89/90/a3be7a5f378fc6e84abe4dcfb2ba32b07786861172e502388b4c90000d1b/greenlet-3.3.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:59913f1e5ada20fde795ba906916aea25d442abcc0593fba7e26c92b7ad76249", size = 1676092, upload-time = "2026-01-23T15:33:52.176Z" }, + { url = "https://files.pythonhosted.org/packages/e1/2b/98c7f93e6db9977aaee07eb1e51ca63bd5f779b900d362791d3252e60558/greenlet-3.3.1-cp314-cp314t-win_amd64.whl", hash = "sha256:301860987846c24cb8964bdec0e31a96ad4a2a801b41b4ef40963c1b44f33451", size = 233181, upload-time = "2026-01-23T15:33:00.29Z" }, +] + +[[package]] +name = "h11" +version = "0.16.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/01/ee/02a2c011bdab74c6fb3c75474d40b3052059d95df7e73351460c8588d963/h11-0.16.0.tar.gz", hash = "sha256:4e35b956cf45792e4caa5885e69fba00bdbc6ffafbfa020300e549b208ee5ff1", size = 101250, upload-time = "2025-04-24T03:35:25.427Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/04/4b/29cac41a4d98d144bf5f6d33995617b185d14b22401f75ca86f384e87ff1/h11-0.16.0-py3-none-any.whl", hash = "sha256:63cf8bbe7522de3bf65932fda1d9c2772064ffb3dae62d55932da54b31cb6c86", size = 37515, upload-time = "2025-04-24T03:35:24.344Z" }, +] + +[[package]] +name = "httpcore" +version = "1.0.9" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "certifi" }, + { name = "h11" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/06/94/82699a10bca87a5556c9c59b5963f2d039dbd239f25bc2a63907a05a14cb/httpcore-1.0.9.tar.gz", hash = "sha256:6e34463af53fd2ab5d807f399a9b45ea31c3dfa2276f15a2c3f00afff6e176e8", size = 85484, upload-time = "2025-04-24T22:06:22.219Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/7e/f5/f66802a942d491edb555dd61e3a9961140fd64c90bce1eafd741609d334d/httpcore-1.0.9-py3-none-any.whl", hash = "sha256:2d400746a40668fc9dec9810239072b40b4484b640a8c38fd654a024c7a1bf55", size = 78784, upload-time = "2025-04-24T22:06:20.566Z" }, +] + +[[package]] +name = "httptools" +version = "0.8.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/43/e5/d471fcb0e14523fe1c3f4ba58ca52480e7bd70ad7109a3846bc75892f7fb/httptools-0.8.0.tar.gz", hash = "sha256:6b2a32f18d97e16e90827d7a819ffa8dbd8cc245fc4e1fa9d1095b54ef4bd999", size = 271342, upload-time = "2026-05-25T22:17:48.841Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f8/d2/c3eedaef57de65c3cc5f8dc244cf12d09c84ad258a479055aad6db23206c/httptools-0.8.0-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:ed377e64805bdba4943c82717333f8f8603a13b09aff9cead2717c6c817fb168", size = 208428, upload-time = "2026-05-25T22:16:59.717Z" }, + { url = "https://files.pythonhosted.org/packages/f1/94/dfe435d90d0ef61ec0f2cc3d480eef78c59727c6c2ce039f433882f6131a/httptools-0.8.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:9518c406d7b310f05adb1a37f80acabac40504a575d7c0da6d3e365c695ac20d", size = 113366, upload-time = "2026-05-25T22:17:00.795Z" }, + { url = "https://files.pythonhosted.org/packages/cc/d4/13025f1a56e615dcb331e0bbe2d9a1143212b58c263385fc5d2e558f5bac/httptools-0.8.0-cp311-cp311-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:57278e6fa0424c42a8a3e454828ab4f0aff27b40cddf9679579b98c6dce6a376", size = 464676, upload-time = "2026-05-25T22:17:02.014Z" }, + { url = "https://files.pythonhosted.org/packages/bf/95/4c1c26c0b985f8a3331682d802598f14e32dc41bf7509266eb2c04ad4801/httptools-0.8.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:bbb8caadb2b742d293169d2b458b5c001ef70e3158704aa3d3ef9597624c5d1d", size = 464235, upload-time = "2026-05-25T22:17:03.109Z" }, + { url = "https://files.pythonhosted.org/packages/a2/82/6735be2b0ca527718c431cdb8e5f70c3862c0844a687df0f572c51e11497/httptools-0.8.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:52dd695b865fe96d9d2b16b64a895f3f57bf3cb064e8383cd3b5713a069e8085", size = 449809, upload-time = "2026-05-25T22:17:04.443Z" }, + { url = "https://files.pythonhosted.org/packages/b5/f9/5811c74f37a758c8a4aa3dc430375119d335947e883efc4664d8f3559a41/httptools-0.8.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:20b4aac66ff65f7db06a375808b78f42a94970aa22e826b3cb2b43eb09174124", size = 452174, upload-time = "2026-05-25T22:17:05.476Z" }, + { url = "https://files.pythonhosted.org/packages/cc/94/97b75870dea07b71e3ec535cebe525b08d723152e4c7d13fa887e51f4de2/httptools-0.8.0-cp311-cp311-win_amd64.whl", hash = "sha256:a1b4c8e7a489a0d750d91894e9a8cdc295838f1924c0ca903ae993456fddec07", size = 90991, upload-time = "2026-05-25T22:17:06.75Z" }, + { url = "https://files.pythonhosted.org/packages/14/88/1d21a36da8f5cb0fa49eafd4b169eba5608d57e75bbcf61845cbc6243216/httptools-0.8.0-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:880490234c10f70a9830743097e8958d6e4b9f5a0ffc24515023afeef984054d", size = 208247, upload-time = "2026-05-25T22:17:07.843Z" }, + { url = "https://files.pythonhosted.org/packages/a5/42/cc4feea2945cb3051038f090c9b36bd5b8a9d7f5a894a506a8983e33fd1c/httptools-0.8.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:5931891fb7b441b8a3853cf1b85c82c903defce084dd5f6771ca46e31bf862c5", size = 113064, upload-time = "2026-05-25T22:17:09.136Z" }, + { url = "https://files.pythonhosted.org/packages/e3/a6/febbb8b8db0f58b38e44ad6cb946e6a255ae49b55f2e8543408fb7501ccd/httptools-0.8.0-cp312-cp312-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:b15fc622b0f869d19207c4089a501d9bcc63ca5e071ffdd2f03f922df882dcb2", size = 523851, upload-time = "2026-05-25T22:17:10.106Z" }, + { url = "https://files.pythonhosted.org/packages/b7/e4/f90a0df0b83beff265b7e3b65f2a4cefd95792d4be0ac3e16049f2acd3c2/httptools-0.8.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:425f83884fd6343828d8c565f046cb72b6d19063f6924093e11bcd8e1548cd09", size = 518842, upload-time = "2026-05-25T22:17:11.218Z" }, + { url = "https://files.pythonhosted.org/packages/9e/2d/0c9ac76dd2c893841fbf6498d6acec4f2442e1b7067f6e3e316a80e494e8/httptools-0.8.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:ef7c3c97f4311c7be57e2986629df89d49cb434dbff78eafcd48c2bff986b15a", size = 501238, upload-time = "2026-05-25T22:17:12.728Z" }, + { url = "https://files.pythonhosted.org/packages/ca/42/906adc91ae3a5fa9c59c0a2f21c139725bd7e5b41ae6acd485cd14123ebf/httptools-0.8.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:a1afd7c9fbff0d9f5d489c4ce2768bd09c84a46ddefc7161e6aa82ae35c85745", size = 509567, upload-time = "2026-05-25T22:17:13.842Z" }, + { url = "https://files.pythonhosted.org/packages/05/0b/4240efeb672751ee5b9b380cb0e3fdc050bc05f68adc7a8aefc4fcd9a69a/httptools-0.8.0-cp312-cp312-win_amd64.whl", hash = "sha256:cd96f29b4bab1d42fa6e3d008711c75e0f79e94e06827330160e3a304227f150", size = 90918, upload-time = "2026-05-25T22:17:15.155Z" }, + { url = "https://files.pythonhosted.org/packages/5e/e5/8cfcabc5546e8022f168be28bcdaa128a240a0befdd03b59d558b4f18bd6/httptools-0.8.0-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:614ceea8ea606848bece2338ac03b3ce5324bcb4be8dc7d377ed708012fa4db8", size = 205148, upload-time = "2026-05-25T22:17:16.333Z" }, + { url = "https://files.pythonhosted.org/packages/2a/0e/0fb14848c19a686c8062ff9067c1a48793e3224b47bc5b201535b6036fce/httptools-0.8.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:2d689918c15a013c65ef52d9fd495d766893ab831a2c8d89f2ac5940a5df847c", size = 111368, upload-time = "2026-05-25T22:17:17.586Z" }, + { url = "https://files.pythonhosted.org/packages/2e/1b/46f1cecf06b9bbde8e4b8c88034ac7908989e5ff7a3a388ef38392949c1f/httptools-0.8.0-cp313-cp313-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:eb3028cca2fc0a6d720e52ef61d8ebb62fcbfeb1de56874546d858d3f25a26b7", size = 486447, upload-time = "2026-05-25T22:17:18.564Z" }, + { url = "https://files.pythonhosted.org/packages/77/00/258bfc0837221f81d9725c45f9b948a6a6b2994a147a4fb66e85100c668f/httptools-0.8.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:88bdd940f2b5d487b4d032c6afa5489a7dc4694410d43de3c38c4fb3af0dc45d", size = 482448, upload-time = "2026-05-25T22:17:19.912Z" }, + { url = "https://files.pythonhosted.org/packages/04/ab/d1cef3b5523f4d272a70f42a776c3169a2dddfe3a54de4b2ce4a36341528/httptools-0.8.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:6a43c9dd399758ccc0531acb0a3c4a6c299ee893ee9400e9c893b7bdcfae0681", size = 464460, upload-time = "2026-05-25T22:17:20.882Z" }, + { url = "https://files.pythonhosted.org/packages/ce/48/5d1d072442277bb2b3434e0e60690b8e8c23840ef7de8b6ea54040a536d3/httptools-0.8.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:0770728beb05094c809b98e814edff5fef69d26ad7d21185f2f6d5884a0ba683", size = 471312, upload-time = "2026-05-25T22:17:22.085Z" }, + { url = "https://files.pythonhosted.org/packages/0d/66/b96623b27e51a68199ef4efdda0613cced9233fe3062ac74e50749c5ad37/httptools-0.8.0-cp313-cp313-win_amd64.whl", hash = "sha256:7685df791fad561384bfb139e77fde27a1ffd93134e016f95a0db424ffbf77b1", size = 90117, upload-time = "2026-05-25T22:17:23.074Z" }, + { url = "https://files.pythonhosted.org/packages/1a/12/fa3fbf5f9517b273edea2dc982aa82a8c634091e67c590792b729017bc6f/httptools-0.8.0-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:de242a49b5d18e0a8776e654e9f6bf6d89f3875a5c35b425a0e7ce940feb3fd6", size = 206183, upload-time = "2026-05-25T22:17:24.004Z" }, + { url = "https://files.pythonhosted.org/packages/30/fc/5e7c4cb443370f2090a3aba0453a07384d29ff66b7435bb90e77e1037599/httptools-0.8.0-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:159e9ab5f701ccd42e555a12f1ad8ff69702910fc1c996cf2bb66e5fcb7a231b", size = 112079, upload-time = "2026-05-25T22:17:25.216Z" }, + { url = "https://files.pythonhosted.org/packages/ba/53/771bd891eb0f236f32145d6a1775777ec85745f3cc983a1f23d1a3b8ddfe/httptools-0.8.0-cp314-cp314-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:c4a9f1707e4823d54dfec6c33fa3697d302aed536ed352a7ebb5a061ddb869d0", size = 481596, upload-time = "2026-05-25T22:17:26.186Z" }, + { url = "https://files.pythonhosted.org/packages/62/42/94e15bc68ce3d423243c45d7f1b0c7561f13844f97dc52ae23182fb65628/httptools-0.8.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d76ad7b951387e3632c8716a9bb03ac5b45c5f16119aa409db0459520887944e", size = 480865, upload-time = "2026-05-25T22:17:27.542Z" }, + { url = "https://files.pythonhosted.org/packages/1c/7c/fe2980fc03723272e30f135b62360b075f513dfe7cc73aef36c7f04012bd/httptools-0.8.0-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:a3b7387147361c3fd47a0bde763c5c91b5b4cd4dc9989b8ece84ff436c99843b", size = 463189, upload-time = "2026-05-25T22:17:28.546Z" }, + { url = "https://files.pythonhosted.org/packages/15/1b/47fc5fff68acd1bfa20b4734059c9a06cadb88119dcd5258b5b0d21d91c8/httptools-0.8.0-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:f256d6ce930c52ca1cb2a960b7da03548c454e7d28b06059ad41bfe789036ce0", size = 466610, upload-time = "2026-05-25T22:17:29.816Z" }, + { url = "https://files.pythonhosted.org/packages/60/bd/07b13c93ffd9bec9546e0d43f8e19378dd696dbd278511406bc07371ef1f/httptools-0.8.0-cp314-cp314-win_amd64.whl", hash = "sha256:19d1ee275bb59ba2643ba9a3a1e51cc0c788caf2b8df506368e03f56fdd08527", size = 92705, upload-time = "2026-05-25T22:17:31.133Z" }, + { url = "https://files.pythonhosted.org/packages/fd/c4/121648f68ce066d7bd762d6b6d97e620847642d38d54f3d90ff11d947629/httptools-0.8.0-cp314-cp314t-macosx_10_13_universal2.whl", hash = "sha256:de1ed58a974e75d56560acc7e7fed01a454994429456f65209789992e41f2568", size = 215023, upload-time = "2026-05-25T22:17:32.401Z" }, + { url = "https://files.pythonhosted.org/packages/b9/b0/312a062ae741ae3e8baa8c8bf20be81b2e67337b259ab4349bebc7b6142e/httptools-0.8.0-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:e93c227b595c6926c1acee96891dd9da4be338cfbe82e5cd3bb9d8dd7dc4ac0b", size = 117405, upload-time = "2026-05-25T22:17:33.742Z" }, + { url = "https://files.pythonhosted.org/packages/fc/37/fccd705f795386bb05bf413012fecff2a33e5aa8c2f069096de3e9fd8702/httptools-0.8.0-cp314-cp314t-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:2a021c3a8e65cc125390d72f59b968afca3bdcaff25bd67965e0a055a14946ca", size = 558497, upload-time = "2026-05-25T22:17:34.732Z" }, + { url = "https://files.pythonhosted.org/packages/bd/39/f172e8003576de35f5ba77ff417cf0e34429d35dc014deef15afa337a72c/httptools-0.8.0-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:48774d39cbb70e2b1f71f88852a3087ae1d3a1eb80482bb48c13067ab080c14f", size = 571585, upload-time = "2026-05-25T22:17:35.813Z" }, + { url = "https://files.pythonhosted.org/packages/3e/b9/f5564760af99f3dbbf3f9104dc00e5da27e96cf433c6bdcf77617f70bf3f/httptools-0.8.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:88eead8ec8680a9f146c655bc88445a325bd7921cfd8194c7337e9467282427d", size = 543297, upload-time = "2026-05-25T22:17:37.08Z" }, + { url = "https://files.pythonhosted.org/packages/99/67/8d9f2c313618e161b82f3873188e7196126da1d6e29688df40eb3997c77a/httptools-0.8.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:2c032fa028f46871ec7e1fc59fc15e8023eab3e6bbe6ece786a1611719a5d081", size = 539535, upload-time = "2026-05-25T22:17:38.032Z" }, + { url = "https://files.pythonhosted.org/packages/48/63/b906c01e53f50d432c0defe43ce52764a111dc1bdd028bafbeb54dcfd008/httptools-0.8.0-cp314-cp314t-win_amd64.whl", hash = "sha256:384c17174464c8e873398b7af24f0b1f44d992c820328413951a625323155d77", size = 108209, upload-time = "2026-05-25T22:17:39.473Z" }, +] + +[[package]] +name = "httpx" +version = "0.28.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "anyio" }, + { name = "certifi" }, + { name = "httpcore" }, + { name = "idna" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/b1/df/48c586a5fe32a0f01324ee087459e112ebb7224f646c0b5023f5e79e9956/httpx-0.28.1.tar.gz", hash = "sha256:75e98c5f16b0f35b567856f597f06ff2270a374470a5c2392242528e3e3e42fc", size = 141406, upload-time = "2024-12-06T15:37:23.222Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/2a/39/e50c7c3a983047577ee07d2a9e53faf5a69493943ec3f6a384bdc792deb2/httpx-0.28.1-py3-none-any.whl", hash = "sha256:d909fcccc110f8c7faf814ca82a9a4d816bc5a6dbfea25d6591d6985b8ba59ad", size = 73517, upload-time = "2024-12-06T15:37:21.509Z" }, +] + +[[package]] +name = "idna" +version = "3.18" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/cd/63/9496c57188a2ee585e0f1db071d75089a11e98aa86eb99d9d7618fc1edce/idna-3.18.tar.gz", hash = "sha256:ffb385a7e039654cef1ab9ef32c6fafe283c0c0467bba1d9029738ce4a14a848", size = 196711, upload-time = "2026-06-02T14:34:07.794Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1e/5e/d4e9f1a599fb8e573b7b87160658329fbf28d19eac2718f51fc3def3aa5a/idna-3.18-py3-none-any.whl", hash = "sha256:7f952cbe720b688055e3f87de14f5c3e5fdaa8bc3928985c4077ca689de849a2", size = 65455, upload-time = "2026-06-02T14:34:06.319Z" }, +] + +[[package]] +name = "ifaddr" +version = "0.2.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/e8/ac/fb4c578f4a3256561548cd825646680edcadb9440f3f68add95ade1eb791/ifaddr-0.2.0.tar.gz", hash = "sha256:cc0cbfcaabf765d44595825fb96a99bb12c79716b73b44330ea38ee2b0c4aed4", size = 10485, upload-time = "2022-06-15T21:40:27.561Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/9c/1f/19ebc343cc71a7ffa78f17018535adc5cbdd87afb31d7c34874680148b32/ifaddr-0.2.0-py3-none-any.whl", hash = "sha256:085e0305cfe6f16ab12d72e2024030f5d52674afad6911bb1eee207177b8a748", size = 12314, upload-time = "2022-06-15T21:40:25.756Z" }, +] + +[[package]] +name = "imagesize" +version = "1.4.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/a7/84/62473fb57d61e31fef6e36d64a179c8781605429fd927b5dd608c997be31/imagesize-1.4.1.tar.gz", hash = "sha256:69150444affb9cb0d5cc5a92b3676f0b2fb7cd9ae39e947a5e11a36b4497cd4a", size = 1280026, upload-time = "2022-07-01T12:21:05.687Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ff/62/85c4c919272577931d407be5ba5d71c20f0b616d31a0befe0ae45bb79abd/imagesize-1.4.1-py2.py3-none-any.whl", hash = "sha256:0d8d18d08f840c19d0ee7ca1fd82490fdc3729b7ac93f49870406ddde8ef8d8b", size = 8769, upload-time = "2022-07-01T12:21:02.467Z" }, +] + +[[package]] +name = "iniconfig" +version = "2.3.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/72/34/14ca021ce8e5dfedc35312d08ba8bf51fdd999c576889fc2c24cb97f4f10/iniconfig-2.3.0.tar.gz", hash = "sha256:c76315c77db068650d49c5b56314774a7804df16fee4402c1f19d6d15d8c4730", size = 20503, upload-time = "2025-10-18T21:55:43.219Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/cb/b1/3846dd7f199d53cb17f49cba7e651e9ce294d8497c8c150530ed11865bb8/iniconfig-2.3.0-py3-none-any.whl", hash = "sha256:f631c04d2c48c52b84d0d0549c99ff3859c98df65b3101406327ecc7d53fbf12", size = 7484, upload-time = "2025-10-18T21:55:41.639Z" }, +] + +[[package]] +name = "ipykernel" +version = "7.2.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "appnope", marker = "sys_platform == 'darwin'" }, + { name = "comm" }, + { name = "debugpy" }, + { name = "ipython" }, + { name = "jupyter-client" }, + { name = "jupyter-core" }, + { name = "matplotlib-inline" }, + { name = "nest-asyncio" }, + { name = "packaging" }, + { name = "psutil" }, + { name = "pyzmq" }, + { name = "tornado" }, + { name = "traitlets" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/ca/8d/b68b728e2d06b9e0051019640a40a9eb7a88fcd82c2e1b5ce70bef5ff044/ipykernel-7.2.0.tar.gz", hash = "sha256:18ed160b6dee2cbb16e5f3575858bc19d8f1fe6046a9a680c708494ce31d909e", size = 176046, upload-time = "2026-02-06T16:43:27.403Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/82/b9/e73d5d9f405cba7706c539aa8b311b49d4c2f3d698d9c12f815231169c71/ipykernel-7.2.0-py3-none-any.whl", hash = "sha256:3bbd4420d2b3cc105cbdf3756bfc04500b1e52f090a90716851f3916c62e1661", size = 118788, upload-time = "2026-02-06T16:43:25.149Z" }, +] + +[[package]] +name = "ipython" +version = "9.10.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "colorama", marker = "sys_platform == 'win32'" }, + { name = "decorator" }, + { name = "ipython-pygments-lexers" }, + { name = "jedi" }, + { name = "matplotlib-inline" }, + { name = "pexpect", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "prompt-toolkit" }, + { name = "pygments" }, + { name = "stack-data" }, + { name = "traitlets" }, + { name = "typing-extensions", marker = "python_full_version < '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/a6/60/2111715ea11f39b1535bed6024b7dec7918b71e5e5d30855a5b503056b50/ipython-9.10.0.tar.gz", hash = "sha256:cd9e656be97618a0676d058134cd44e6dc7012c0e5cb36a9ce96a8c904adaf77", size = 4426526, upload-time = "2026-02-02T10:00:33.594Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/3d/aa/898dec789a05731cd5a9f50605b7b44a72bd198fd0d4528e11fc610177cc/ipython-9.10.0-py3-none-any.whl", hash = "sha256:c6ab68cc23bba8c7e18e9b932797014cc61ea7fd6f19de180ab9ba73e65ee58d", size = 622774, upload-time = "2026-02-02T10:00:31.503Z" }, +] + +[[package]] +name = "ipython-pygments-lexers" +version = "1.1.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pygments" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/ef/4c/5dd1d8af08107f88c7f741ead7a40854b8ac24ddf9ae850afbcf698aa552/ipython_pygments_lexers-1.1.1.tar.gz", hash = "sha256:09c0138009e56b6854f9535736f4171d855c8c08a563a0dcd8022f78355c7e81", size = 8393, upload-time = "2025-01-17T11:24:34.505Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d9/33/1f075bf72b0b747cb3288d011319aaf64083cf2efef8354174e3ed4540e2/ipython_pygments_lexers-1.1.1-py3-none-any.whl", hash = "sha256:a9462224a505ade19a605f71f8fa63c2048833ce50abc86768a0d81d876dc81c", size = 8074, upload-time = "2025-01-17T11:24:33.271Z" }, +] + +[[package]] +name = "ipywidgets" +version = "8.1.8" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "comm" }, + { name = "ipython" }, + { name = "jupyterlab-widgets" }, + { name = "traitlets" }, + { name = "widgetsnbextension" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/4c/ae/c5ce1edc1afe042eadb445e95b0671b03cee61895264357956e61c0d2ac0/ipywidgets-8.1.8.tar.gz", hash = "sha256:61f969306b95f85fba6b6986b7fe45d73124d1d9e3023a8068710d47a22ea668", size = 116739, upload-time = "2025-11-01T21:18:12.393Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/56/6d/0d9848617b9f753b87f214f1c682592f7ca42de085f564352f10f0843026/ipywidgets-8.1.8-py3-none-any.whl", hash = "sha256:ecaca67aed704a338f88f67b1181b58f821ab5dc89c1f0f5ef99db43c1c2921e", size = 139808, upload-time = "2025-11-01T21:18:10.956Z" }, +] + +[[package]] +name = "itsdangerous" +version = "2.2.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/9c/cb/8ac0172223afbccb63986cc25049b154ecfb5e85932587206f42317be31d/itsdangerous-2.2.0.tar.gz", hash = "sha256:e0050c0b7da1eea53ffaf149c0cfbb5c6e2e2b69c4bef22c81fa6eb73e5f6173", size = 54410, upload-time = "2024-04-16T21:28:15.614Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/04/96/92447566d16df59b2a776c0fb82dbc4d9e07cd95062562af01e408583fc4/itsdangerous-2.2.0-py3-none-any.whl", hash = "sha256:c6242fc49e35958c8b15141343aa660db5fc54d4f13a1db01a3f5891b98700ef", size = 16234, upload-time = "2024-04-16T21:28:14.499Z" }, +] + +[[package]] +name = "jedi" +version = "0.19.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "parso" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/72/3a/79a912fbd4d8dd6fbb02bf69afd3bb72cf0c729bb3063c6f4498603db17a/jedi-0.19.2.tar.gz", hash = "sha256:4770dc3de41bde3966b02eb84fbcf557fb33cce26ad23da12c742fb50ecb11f0", size = 1231287, upload-time = "2024-11-11T01:41:42.873Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c0/5a/9cac0c82afec3d09ccd97c8b6502d48f165f9124db81b4bcb90b4af974ee/jedi-0.19.2-py2.py3-none-any.whl", hash = "sha256:a8ef22bde8490f57fe5c7681a3c83cb58874daf72b4784de3cce5b6ef6edb5b9", size = 1572278, upload-time = "2024-11-11T01:41:40.175Z" }, +] + +[[package]] +name = "jinja2" +version = "3.1.6" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "markupsafe" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/df/bf/f7da0350254c0ed7c72f3e33cef02e048281fec7ecec5f032d4aac52226b/jinja2-3.1.6.tar.gz", hash = "sha256:0137fb05990d35f1275a587e9aee6d56da821fc83491a0fb838183be43f66d6d", size = 245115, upload-time = "2025-03-05T20:05:02.478Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/62/a1/3d680cbfd5f4b8f15abc1d571870c5fc3e594bb582bc3b64ea099db13e56/jinja2-3.1.6-py3-none-any.whl", hash = "sha256:85ece4451f492d0c13c5dd7c13a64681a86afae63a5f347908daf103ce6d2f67", size = 134899, upload-time = "2025-03-05T20:05:00.369Z" }, +] + +[[package]] +name = "joblib" +version = "1.5.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/41/f2/d34e8b3a08a9cc79a50b2208a93dce981fe615b64d5a4d4abee421d898df/joblib-1.5.3.tar.gz", hash = "sha256:8561a3269e6801106863fd0d6d84bb737be9e7631e33aaed3fb9ce5953688da3", size = 331603, upload-time = "2025-12-15T08:41:46.427Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/7b/91/984aca2ec129e2757d1e4e3c81c3fcda9d0f85b74670a094cc443d9ee949/joblib-1.5.3-py3-none-any.whl", hash = "sha256:5fc3c5039fc5ca8c0276333a188bbd59d6b7ab37fe6632daa76bc7f9ec18e713", size = 309071, upload-time = "2025-12-15T08:41:44.973Z" }, +] + +[[package]] +name = "jupyter-client" +version = "8.8.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "jupyter-core" }, + { name = "python-dateutil" }, + { name = "pyzmq" }, + { name = "tornado" }, + { name = "traitlets" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/05/e4/ba649102a3bc3fbca54e7239fb924fd434c766f855693d86de0b1f2bec81/jupyter_client-8.8.0.tar.gz", hash = "sha256:d556811419a4f2d96c869af34e854e3f059b7cc2d6d01a9cd9c85c267691be3e", size = 348020, upload-time = "2026-01-08T13:55:47.938Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/2d/0b/ceb7694d864abc0a047649aec263878acb9f792e1fec3e676f22dc9015e3/jupyter_client-8.8.0-py3-none-any.whl", hash = "sha256:f93a5b99c5e23a507b773d3a1136bd6e16c67883ccdbd9a829b0bbdb98cd7d7a", size = 107371, upload-time = "2026-01-08T13:55:45.562Z" }, +] + +[[package]] +name = "jupyter-core" +version = "5.9.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "platformdirs" }, + { name = "traitlets" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/02/49/9d1284d0dc65e2c757b74c6687b6d319b02f822ad039e5c512df9194d9dd/jupyter_core-5.9.1.tar.gz", hash = "sha256:4d09aaff303b9566c3ce657f580bd089ff5c91f5f89cf7d8846c3cdf465b5508", size = 89814, upload-time = "2025-10-16T19:19:18.444Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e7/e7/80988e32bf6f73919a113473a604f5a8f09094de312b9d52b79c2df7612b/jupyter_core-5.9.1-py3-none-any.whl", hash = "sha256:ebf87fdc6073d142e114c72c9e29a9d7ca03fad818c5d300ce2adc1fb0743407", size = 29032, upload-time = "2025-10-16T19:19:16.783Z" }, +] + +[[package]] +name = "jupyterlab-widgets" +version = "3.0.16" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/26/2d/ef58fed122b268c69c0aa099da20bc67657cdfb2e222688d5731bd5b971d/jupyterlab_widgets-3.0.16.tar.gz", hash = "sha256:423da05071d55cf27a9e602216d35a3a65a3e41cdf9c5d3b643b814ce38c19e0", size = 897423, upload-time = "2025-11-01T21:11:29.724Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ab/b5/36c712098e6191d1b4e349304ef73a8d06aed77e56ceaac8c0a306c7bda1/jupyterlab_widgets-3.0.16-py3-none-any.whl", hash = "sha256:45fa36d9c6422cf2559198e4db481aa243c7a32d9926b500781c830c80f7ecf8", size = 914926, upload-time = "2025-11-01T21:11:28.008Z" }, +] + +[[package]] +name = "kiwisolver" +version = "1.4.9" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/5c/3c/85844f1b0feb11ee581ac23fe5fce65cd049a200c1446708cc1b7f922875/kiwisolver-1.4.9.tar.gz", hash = "sha256:c3b22c26c6fd6811b0ae8363b95ca8ce4ea3c202d3d0975b2914310ceb1bcc4d", size = 97564, upload-time = "2025-08-10T21:27:49.279Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/6f/ab/c80b0d5a9d8a1a65f4f815f2afff9798b12c3b9f31f1d304dd233dd920e2/kiwisolver-1.4.9-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:eb14a5da6dc7642b0f3a18f13654847cd8b7a2550e2645a5bda677862b03ba16", size = 124167, upload-time = "2025-08-10T21:25:53.403Z" }, + { url = "https://files.pythonhosted.org/packages/a0/c0/27fe1a68a39cf62472a300e2879ffc13c0538546c359b86f149cc19f6ac3/kiwisolver-1.4.9-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:39a219e1c81ae3b103643d2aedb90f1ef22650deb266ff12a19e7773f3e5f089", size = 66579, upload-time = "2025-08-10T21:25:54.79Z" }, + { url = "https://files.pythonhosted.org/packages/31/a2/a12a503ac1fd4943c50f9822678e8015a790a13b5490354c68afb8489814/kiwisolver-1.4.9-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:2405a7d98604b87f3fc28b1716783534b1b4b8510d8142adca34ee0bc3c87543", size = 65309, upload-time = "2025-08-10T21:25:55.76Z" }, + { url = "https://files.pythonhosted.org/packages/66/e1/e533435c0be77c3f64040d68d7a657771194a63c279f55573188161e81ca/kiwisolver-1.4.9-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:dc1ae486f9abcef254b5618dfb4113dd49f94c68e3e027d03cf0143f3f772b61", size = 1435596, upload-time = "2025-08-10T21:25:56.861Z" }, + { url = "https://files.pythonhosted.org/packages/67/1e/51b73c7347f9aabdc7215aa79e8b15299097dc2f8e67dee2b095faca9cb0/kiwisolver-1.4.9-cp311-cp311-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:8a1f570ce4d62d718dce3f179ee78dac3b545ac16c0c04bb363b7607a949c0d1", size = 1246548, upload-time = "2025-08-10T21:25:58.246Z" }, + { url = "https://files.pythonhosted.org/packages/21/aa/72a1c5d1e430294f2d32adb9542719cfb441b5da368d09d268c7757af46c/kiwisolver-1.4.9-cp311-cp311-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:cb27e7b78d716c591e88e0a09a2139c6577865d7f2e152488c2cc6257f460872", size = 1263618, upload-time = "2025-08-10T21:25:59.857Z" }, + { url = "https://files.pythonhosted.org/packages/a3/af/db1509a9e79dbf4c260ce0cfa3903ea8945f6240e9e59d1e4deb731b1a40/kiwisolver-1.4.9-cp311-cp311-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:15163165efc2f627eb9687ea5f3a28137217d217ac4024893d753f46bce9de26", size = 1317437, upload-time = "2025-08-10T21:26:01.105Z" }, + { url = "https://files.pythonhosted.org/packages/e0/f2/3ea5ee5d52abacdd12013a94130436e19969fa183faa1e7c7fbc89e9a42f/kiwisolver-1.4.9-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:bdee92c56a71d2b24c33a7d4c2856bd6419d017e08caa7802d2963870e315028", size = 2195742, upload-time = "2025-08-10T21:26:02.675Z" }, + { url = "https://files.pythonhosted.org/packages/6f/9b/1efdd3013c2d9a2566aa6a337e9923a00590c516add9a1e89a768a3eb2fc/kiwisolver-1.4.9-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:412f287c55a6f54b0650bd9b6dce5aceddb95864a1a90c87af16979d37c89771", size = 2290810, upload-time = "2025-08-10T21:26:04.009Z" }, + { url = "https://files.pythonhosted.org/packages/fb/e5/cfdc36109ae4e67361f9bc5b41323648cb24a01b9ade18784657e022e65f/kiwisolver-1.4.9-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:2c93f00dcba2eea70af2be5f11a830a742fe6b579a1d4e00f47760ef13be247a", size = 2461579, upload-time = "2025-08-10T21:26:05.317Z" }, + { url = "https://files.pythonhosted.org/packages/62/86/b589e5e86c7610842213994cdea5add00960076bef4ae290c5fa68589cac/kiwisolver-1.4.9-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:f117e1a089d9411663a3207ba874f31be9ac8eaa5b533787024dc07aeb74f464", size = 2268071, upload-time = "2025-08-10T21:26:06.686Z" }, + { url = "https://files.pythonhosted.org/packages/3b/c6/f8df8509fd1eee6c622febe54384a96cfaf4d43bf2ccec7a0cc17e4715c9/kiwisolver-1.4.9-cp311-cp311-win_amd64.whl", hash = "sha256:be6a04e6c79819c9a8c2373317d19a96048e5a3f90bec587787e86a1153883c2", size = 73840, upload-time = "2025-08-10T21:26:07.94Z" }, + { url = "https://files.pythonhosted.org/packages/e2/2d/16e0581daafd147bc11ac53f032a2b45eabac897f42a338d0a13c1e5c436/kiwisolver-1.4.9-cp311-cp311-win_arm64.whl", hash = "sha256:0ae37737256ba2de764ddc12aed4956460277f00c4996d51a197e72f62f5eec7", size = 65159, upload-time = "2025-08-10T21:26:09.048Z" }, + { url = "https://files.pythonhosted.org/packages/86/c9/13573a747838aeb1c76e3267620daa054f4152444d1f3d1a2324b78255b5/kiwisolver-1.4.9-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:ac5a486ac389dddcc5bef4f365b6ae3ffff2c433324fb38dd35e3fab7c957999", size = 123686, upload-time = "2025-08-10T21:26:10.034Z" }, + { url = "https://files.pythonhosted.org/packages/51/ea/2ecf727927f103ffd1739271ca19c424d0e65ea473fbaeea1c014aea93f6/kiwisolver-1.4.9-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:f2ba92255faa7309d06fe44c3a4a97efe1c8d640c2a79a5ef728b685762a6fd2", size = 66460, upload-time = "2025-08-10T21:26:11.083Z" }, + { url = "https://files.pythonhosted.org/packages/5b/5a/51f5464373ce2aeb5194508298a508b6f21d3867f499556263c64c621914/kiwisolver-1.4.9-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:4a2899935e724dd1074cb568ce7ac0dce28b2cd6ab539c8e001a8578eb106d14", size = 64952, upload-time = "2025-08-10T21:26:12.058Z" }, + { url = "https://files.pythonhosted.org/packages/70/90/6d240beb0f24b74371762873e9b7f499f1e02166a2d9c5801f4dbf8fa12e/kiwisolver-1.4.9-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:f6008a4919fdbc0b0097089f67a1eb55d950ed7e90ce2cc3e640abadd2757a04", size = 1474756, upload-time = "2025-08-10T21:26:13.096Z" }, + { url = "https://files.pythonhosted.org/packages/12/42/f36816eaf465220f683fb711efdd1bbf7a7005a2473d0e4ed421389bd26c/kiwisolver-1.4.9-cp312-cp312-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:67bb8b474b4181770f926f7b7d2f8c0248cbcb78b660fdd41a47054b28d2a752", size = 1276404, upload-time = "2025-08-10T21:26:14.457Z" }, + { url = "https://files.pythonhosted.org/packages/2e/64/bc2de94800adc830c476dce44e9b40fd0809cddeef1fde9fcf0f73da301f/kiwisolver-1.4.9-cp312-cp312-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:2327a4a30d3ee07d2fbe2e7933e8a37c591663b96ce42a00bc67461a87d7df77", size = 1294410, upload-time = "2025-08-10T21:26:15.73Z" }, + { url = "https://files.pythonhosted.org/packages/5f/42/2dc82330a70aa8e55b6d395b11018045e58d0bb00834502bf11509f79091/kiwisolver-1.4.9-cp312-cp312-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:7a08b491ec91b1d5053ac177afe5290adacf1f0f6307d771ccac5de30592d198", size = 1343631, upload-time = "2025-08-10T21:26:17.045Z" }, + { url = "https://files.pythonhosted.org/packages/22/fd/f4c67a6ed1aab149ec5a8a401c323cee7a1cbe364381bb6c9c0d564e0e20/kiwisolver-1.4.9-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:d8fc5c867c22b828001b6a38d2eaeb88160bf5783c6cb4a5e440efc981ce286d", size = 2224963, upload-time = "2025-08-10T21:26:18.737Z" }, + { url = "https://files.pythonhosted.org/packages/45/aa/76720bd4cb3713314677d9ec94dcc21ced3f1baf4830adde5bb9b2430a5f/kiwisolver-1.4.9-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:3b3115b2581ea35bb6d1f24a4c90af37e5d9b49dcff267eeed14c3893c5b86ab", size = 2321295, upload-time = "2025-08-10T21:26:20.11Z" }, + { url = "https://files.pythonhosted.org/packages/80/19/d3ec0d9ab711242f56ae0dc2fc5d70e298bb4a1f9dfab44c027668c673a1/kiwisolver-1.4.9-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:858e4c22fb075920b96a291928cb7dea5644e94c0ee4fcd5af7e865655e4ccf2", size = 2487987, upload-time = "2025-08-10T21:26:21.49Z" }, + { url = "https://files.pythonhosted.org/packages/39/e9/61e4813b2c97e86b6fdbd4dd824bf72d28bcd8d4849b8084a357bc0dd64d/kiwisolver-1.4.9-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:ed0fecd28cc62c54b262e3736f8bb2512d8dcfdc2bcf08be5f47f96bf405b145", size = 2291817, upload-time = "2025-08-10T21:26:22.812Z" }, + { url = "https://files.pythonhosted.org/packages/a0/41/85d82b0291db7504da3c2defe35c9a8a5c9803a730f297bd823d11d5fb77/kiwisolver-1.4.9-cp312-cp312-win_amd64.whl", hash = "sha256:f68208a520c3d86ea51acf688a3e3002615a7f0238002cccc17affecc86a8a54", size = 73895, upload-time = "2025-08-10T21:26:24.37Z" }, + { url = "https://files.pythonhosted.org/packages/e2/92/5f3068cf15ee5cb624a0c7596e67e2a0bb2adee33f71c379054a491d07da/kiwisolver-1.4.9-cp312-cp312-win_arm64.whl", hash = "sha256:2c1a4f57df73965f3f14df20b80ee29e6a7930a57d2d9e8491a25f676e197c60", size = 64992, upload-time = "2025-08-10T21:26:25.732Z" }, + { url = "https://files.pythonhosted.org/packages/31/c1/c2686cda909742ab66c7388e9a1a8521a59eb89f8bcfbee28fc980d07e24/kiwisolver-1.4.9-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:a5d0432ccf1c7ab14f9949eec60c5d1f924f17c037e9f8b33352fa05799359b8", size = 123681, upload-time = "2025-08-10T21:26:26.725Z" }, + { url = "https://files.pythonhosted.org/packages/ca/f0/f44f50c9f5b1a1860261092e3bc91ecdc9acda848a8b8c6abfda4a24dd5c/kiwisolver-1.4.9-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:efb3a45b35622bb6c16dbfab491a8f5a391fe0e9d45ef32f4df85658232ca0e2", size = 66464, upload-time = "2025-08-10T21:26:27.733Z" }, + { url = "https://files.pythonhosted.org/packages/2d/7a/9d90a151f558e29c3936b8a47ac770235f436f2120aca41a6d5f3d62ae8d/kiwisolver-1.4.9-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:1a12cf6398e8a0a001a059747a1cbf24705e18fe413bc22de7b3d15c67cffe3f", size = 64961, upload-time = "2025-08-10T21:26:28.729Z" }, + { url = "https://files.pythonhosted.org/packages/e9/e9/f218a2cb3a9ffbe324ca29a9e399fa2d2866d7f348ec3a88df87fc248fc5/kiwisolver-1.4.9-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:b67e6efbf68e077dd71d1a6b37e43e1a99d0bff1a3d51867d45ee8908b931098", size = 1474607, upload-time = "2025-08-10T21:26:29.798Z" }, + { url = "https://files.pythonhosted.org/packages/d9/28/aac26d4c882f14de59041636292bc838db8961373825df23b8eeb807e198/kiwisolver-1.4.9-cp313-cp313-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5656aa670507437af0207645273ccdfee4f14bacd7f7c67a4306d0dcaeaf6eed", size = 1276546, upload-time = "2025-08-10T21:26:31.401Z" }, + { url = "https://files.pythonhosted.org/packages/8b/ad/8bfc1c93d4cc565e5069162f610ba2f48ff39b7de4b5b8d93f69f30c4bed/kiwisolver-1.4.9-cp313-cp313-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:bfc08add558155345129c7803b3671cf195e6a56e7a12f3dde7c57d9b417f525", size = 1294482, upload-time = "2025-08-10T21:26:32.721Z" }, + { url = "https://files.pythonhosted.org/packages/da/f1/6aca55ff798901d8ce403206d00e033191f63d82dd708a186e0ed2067e9c/kiwisolver-1.4.9-cp313-cp313-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:40092754720b174e6ccf9e845d0d8c7d8e12c3d71e7fc35f55f3813e96376f78", size = 1343720, upload-time = "2025-08-10T21:26:34.032Z" }, + { url = "https://files.pythonhosted.org/packages/d1/91/eed031876c595c81d90d0f6fc681ece250e14bf6998c3d7c419466b523b7/kiwisolver-1.4.9-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:497d05f29a1300d14e02e6441cf0f5ee81c1ff5a304b0d9fb77423974684e08b", size = 2224907, upload-time = "2025-08-10T21:26:35.824Z" }, + { url = "https://files.pythonhosted.org/packages/e9/ec/4d1925f2e49617b9cca9c34bfa11adefad49d00db038e692a559454dfb2e/kiwisolver-1.4.9-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:bdd1a81a1860476eb41ac4bc1e07b3f07259e6d55bbf739b79c8aaedcf512799", size = 2321334, upload-time = "2025-08-10T21:26:37.534Z" }, + { url = "https://files.pythonhosted.org/packages/43/cb/450cd4499356f68802750c6ddc18647b8ea01ffa28f50d20598e0befe6e9/kiwisolver-1.4.9-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:e6b93f13371d341afee3be9f7c5964e3fe61d5fa30f6a30eb49856935dfe4fc3", size = 2488313, upload-time = "2025-08-10T21:26:39.191Z" }, + { url = "https://files.pythonhosted.org/packages/71/67/fc76242bd99f885651128a5d4fa6083e5524694b7c88b489b1b55fdc491d/kiwisolver-1.4.9-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:d75aa530ccfaa593da12834b86a0724f58bff12706659baa9227c2ccaa06264c", size = 2291970, upload-time = "2025-08-10T21:26:40.828Z" }, + { url = "https://files.pythonhosted.org/packages/75/bd/f1a5d894000941739f2ae1b65a32892349423ad49c2e6d0771d0bad3fae4/kiwisolver-1.4.9-cp313-cp313-win_amd64.whl", hash = "sha256:dd0a578400839256df88c16abddf9ba14813ec5f21362e1fe65022e00c883d4d", size = 73894, upload-time = "2025-08-10T21:26:42.33Z" }, + { url = "https://files.pythonhosted.org/packages/95/38/dce480814d25b99a391abbddadc78f7c117c6da34be68ca8b02d5848b424/kiwisolver-1.4.9-cp313-cp313-win_arm64.whl", hash = "sha256:d4188e73af84ca82468f09cadc5ac4db578109e52acb4518d8154698d3a87ca2", size = 64995, upload-time = "2025-08-10T21:26:43.889Z" }, + { url = "https://files.pythonhosted.org/packages/e2/37/7d218ce5d92dadc5ebdd9070d903e0c7cf7edfe03f179433ac4d13ce659c/kiwisolver-1.4.9-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:5a0f2724dfd4e3b3ac5a82436a8e6fd16baa7d507117e4279b660fe8ca38a3a1", size = 126510, upload-time = "2025-08-10T21:26:44.915Z" }, + { url = "https://files.pythonhosted.org/packages/23/b0/e85a2b48233daef4b648fb657ebbb6f8367696a2d9548a00b4ee0eb67803/kiwisolver-1.4.9-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:1b11d6a633e4ed84fc0ddafd4ebfd8ea49b3f25082c04ad12b8315c11d504dc1", size = 67903, upload-time = "2025-08-10T21:26:45.934Z" }, + { url = "https://files.pythonhosted.org/packages/44/98/f2425bc0113ad7de24da6bb4dae1343476e95e1d738be7c04d31a5d037fd/kiwisolver-1.4.9-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:61874cdb0a36016354853593cffc38e56fc9ca5aa97d2c05d3dcf6922cd55a11", size = 66402, upload-time = "2025-08-10T21:26:47.101Z" }, + { url = "https://files.pythonhosted.org/packages/98/d8/594657886df9f34c4177cc353cc28ca7e6e5eb562d37ccc233bff43bbe2a/kiwisolver-1.4.9-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:60c439763a969a6af93b4881db0eed8fadf93ee98e18cbc35bc8da868d0c4f0c", size = 1582135, upload-time = "2025-08-10T21:26:48.665Z" }, + { url = "https://files.pythonhosted.org/packages/5c/c6/38a115b7170f8b306fc929e166340c24958347308ea3012c2b44e7e295db/kiwisolver-1.4.9-cp313-cp313t-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:92a2f997387a1b79a75e7803aa7ded2cfbe2823852ccf1ba3bcf613b62ae3197", size = 1389409, upload-time = "2025-08-10T21:26:50.335Z" }, + { url = "https://files.pythonhosted.org/packages/bf/3b/e04883dace81f24a568bcee6eb3001da4ba05114afa622ec9b6fafdc1f5e/kiwisolver-1.4.9-cp313-cp313t-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:a31d512c812daea6d8b3be3b2bfcbeb091dbb09177706569bcfc6240dcf8b41c", size = 1401763, upload-time = "2025-08-10T21:26:51.867Z" }, + { url = "https://files.pythonhosted.org/packages/9f/80/20ace48e33408947af49d7d15c341eaee69e4e0304aab4b7660e234d6288/kiwisolver-1.4.9-cp313-cp313t-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:52a15b0f35dad39862d376df10c5230155243a2c1a436e39eb55623ccbd68185", size = 1453643, upload-time = "2025-08-10T21:26:53.592Z" }, + { url = "https://files.pythonhosted.org/packages/64/31/6ce4380a4cd1f515bdda976a1e90e547ccd47b67a1546d63884463c92ca9/kiwisolver-1.4.9-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:a30fd6fdef1430fd9e1ba7b3398b5ee4e2887783917a687d86ba69985fb08748", size = 2330818, upload-time = "2025-08-10T21:26:55.051Z" }, + { url = "https://files.pythonhosted.org/packages/fa/e9/3f3fcba3bcc7432c795b82646306e822f3fd74df0ee81f0fa067a1f95668/kiwisolver-1.4.9-cp313-cp313t-musllinux_1_2_ppc64le.whl", hash = "sha256:cc9617b46837c6468197b5945e196ee9ca43057bb7d9d1ae688101e4e1dddf64", size = 2419963, upload-time = "2025-08-10T21:26:56.421Z" }, + { url = "https://files.pythonhosted.org/packages/99/43/7320c50e4133575c66e9f7dadead35ab22d7c012a3b09bb35647792b2a6d/kiwisolver-1.4.9-cp313-cp313t-musllinux_1_2_s390x.whl", hash = "sha256:0ab74e19f6a2b027ea4f845a78827969af45ce790e6cb3e1ebab71bdf9f215ff", size = 2594639, upload-time = "2025-08-10T21:26:57.882Z" }, + { url = "https://files.pythonhosted.org/packages/65/d6/17ae4a270d4a987ef8a385b906d2bdfc9fce502d6dc0d3aea865b47f548c/kiwisolver-1.4.9-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:dba5ee5d3981160c28d5490f0d1b7ed730c22470ff7f6cc26cfcfaacb9896a07", size = 2391741, upload-time = "2025-08-10T21:26:59.237Z" }, + { url = "https://files.pythonhosted.org/packages/2a/8f/8f6f491d595a9e5912971f3f863d81baddccc8a4d0c3749d6a0dd9ffc9df/kiwisolver-1.4.9-cp313-cp313t-win_arm64.whl", hash = "sha256:0749fd8f4218ad2e851e11cc4dc05c7cbc0cbc4267bdfdb31782e65aace4ee9c", size = 68646, upload-time = "2025-08-10T21:27:00.52Z" }, + { url = "https://files.pythonhosted.org/packages/6b/32/6cc0fbc9c54d06c2969faa9c1d29f5751a2e51809dd55c69055e62d9b426/kiwisolver-1.4.9-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:9928fe1eb816d11ae170885a74d074f57af3a0d65777ca47e9aeb854a1fba386", size = 123806, upload-time = "2025-08-10T21:27:01.537Z" }, + { url = "https://files.pythonhosted.org/packages/b2/dd/2bfb1d4a4823d92e8cbb420fe024b8d2167f72079b3bb941207c42570bdf/kiwisolver-1.4.9-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:d0005b053977e7b43388ddec89fa567f43d4f6d5c2c0affe57de5ebf290dc552", size = 66605, upload-time = "2025-08-10T21:27:03.335Z" }, + { url = "https://files.pythonhosted.org/packages/f7/69/00aafdb4e4509c2ca6064646cba9cd4b37933898f426756adb2cb92ebbed/kiwisolver-1.4.9-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:2635d352d67458b66fd0667c14cb1d4145e9560d503219034a18a87e971ce4f3", size = 64925, upload-time = "2025-08-10T21:27:04.339Z" }, + { url = "https://files.pythonhosted.org/packages/43/dc/51acc6791aa14e5cb6d8a2e28cefb0dc2886d8862795449d021334c0df20/kiwisolver-1.4.9-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:767c23ad1c58c9e827b649a9ab7809fd5fd9db266a9cf02b0e926ddc2c680d58", size = 1472414, upload-time = "2025-08-10T21:27:05.437Z" }, + { url = "https://files.pythonhosted.org/packages/3d/bb/93fa64a81db304ac8a246f834d5094fae4b13baf53c839d6bb6e81177129/kiwisolver-1.4.9-cp314-cp314-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:72d0eb9fba308b8311685c2268cf7d0a0639a6cd027d8128659f72bdd8a024b4", size = 1281272, upload-time = "2025-08-10T21:27:07.063Z" }, + { url = "https://files.pythonhosted.org/packages/70/e6/6df102916960fb8d05069d4bd92d6d9a8202d5a3e2444494e7cd50f65b7a/kiwisolver-1.4.9-cp314-cp314-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f68e4f3eeca8fb22cc3d731f9715a13b652795ef657a13df1ad0c7dc0e9731df", size = 1298578, upload-time = "2025-08-10T21:27:08.452Z" }, + { url = "https://files.pythonhosted.org/packages/7c/47/e142aaa612f5343736b087864dbaebc53ea8831453fb47e7521fa8658f30/kiwisolver-1.4.9-cp314-cp314-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:d84cd4061ae292d8ac367b2c3fa3aad11cb8625a95d135fe93f286f914f3f5a6", size = 1345607, upload-time = "2025-08-10T21:27:10.125Z" }, + { url = "https://files.pythonhosted.org/packages/54/89/d641a746194a0f4d1a3670fb900d0dbaa786fb98341056814bc3f058fa52/kiwisolver-1.4.9-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:a60ea74330b91bd22a29638940d115df9dc00af5035a9a2a6ad9399ffb4ceca5", size = 2230150, upload-time = "2025-08-10T21:27:11.484Z" }, + { url = "https://files.pythonhosted.org/packages/aa/6b/5ee1207198febdf16ac11f78c5ae40861b809cbe0e6d2a8d5b0b3044b199/kiwisolver-1.4.9-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:ce6a3a4e106cf35c2d9c4fa17c05ce0b180db622736845d4315519397a77beaf", size = 2325979, upload-time = "2025-08-10T21:27:12.917Z" }, + { url = "https://files.pythonhosted.org/packages/fc/ff/b269eefd90f4ae14dcc74973d5a0f6d28d3b9bb1afd8c0340513afe6b39a/kiwisolver-1.4.9-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:77937e5e2a38a7b48eef0585114fe7930346993a88060d0bf886086d2aa49ef5", size = 2491456, upload-time = "2025-08-10T21:27:14.353Z" }, + { url = "https://files.pythonhosted.org/packages/fc/d4/10303190bd4d30de547534601e259a4fbf014eed94aae3e5521129215086/kiwisolver-1.4.9-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:24c175051354f4a28c5d6a31c93906dc653e2bf234e8a4bbfb964892078898ce", size = 2294621, upload-time = "2025-08-10T21:27:15.808Z" }, + { url = "https://files.pythonhosted.org/packages/28/e0/a9a90416fce5c0be25742729c2ea52105d62eda6c4be4d803c2a7be1fa50/kiwisolver-1.4.9-cp314-cp314-win_amd64.whl", hash = "sha256:0763515d4df10edf6d06a3c19734e2566368980d21ebec439f33f9eb936c07b7", size = 75417, upload-time = "2025-08-10T21:27:17.436Z" }, + { url = "https://files.pythonhosted.org/packages/1f/10/6949958215b7a9a264299a7db195564e87900f709db9245e4ebdd3c70779/kiwisolver-1.4.9-cp314-cp314-win_arm64.whl", hash = "sha256:0e4e2bf29574a6a7b7f6cb5fa69293b9f96c928949ac4a53ba3f525dffb87f9c", size = 66582, upload-time = "2025-08-10T21:27:18.436Z" }, + { url = "https://files.pythonhosted.org/packages/ec/79/60e53067903d3bc5469b369fe0dfc6b3482e2133e85dae9daa9527535991/kiwisolver-1.4.9-cp314-cp314t-macosx_10_13_universal2.whl", hash = "sha256:d976bbb382b202f71c67f77b0ac11244021cfa3f7dfd9e562eefcea2df711548", size = 126514, upload-time = "2025-08-10T21:27:19.465Z" }, + { url = "https://files.pythonhosted.org/packages/25/d1/4843d3e8d46b072c12a38c97c57fab4608d36e13fe47d47ee96b4d61ba6f/kiwisolver-1.4.9-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:2489e4e5d7ef9a1c300a5e0196e43d9c739f066ef23270607d45aba368b91f2d", size = 67905, upload-time = "2025-08-10T21:27:20.51Z" }, + { url = "https://files.pythonhosted.org/packages/8c/ae/29ffcbd239aea8b93108de1278271ae764dfc0d803a5693914975f200596/kiwisolver-1.4.9-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:e2ea9f7ab7fbf18fffb1b5434ce7c69a07582f7acc7717720f1d69f3e806f90c", size = 66399, upload-time = "2025-08-10T21:27:21.496Z" }, + { url = "https://files.pythonhosted.org/packages/a1/ae/d7ba902aa604152c2ceba5d352d7b62106bedbccc8e95c3934d94472bfa3/kiwisolver-1.4.9-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:b34e51affded8faee0dfdb705416153819d8ea9250bbbf7ea1b249bdeb5f1122", size = 1582197, upload-time = "2025-08-10T21:27:22.604Z" }, + { url = "https://files.pythonhosted.org/packages/f2/41/27c70d427eddb8bc7e4f16420a20fefc6f480312122a59a959fdfe0445ad/kiwisolver-1.4.9-cp314-cp314t-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d8aacd3d4b33b772542b2e01beb50187536967b514b00003bdda7589722d2a64", size = 1390125, upload-time = "2025-08-10T21:27:24.036Z" }, + { url = "https://files.pythonhosted.org/packages/41/42/b3799a12bafc76d962ad69083f8b43b12bf4fe78b097b12e105d75c9b8f1/kiwisolver-1.4.9-cp314-cp314t-manylinux_2_24_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:7cf974dd4e35fa315563ac99d6287a1024e4dc2077b8a7d7cd3d2fb65d283134", size = 1402612, upload-time = "2025-08-10T21:27:25.773Z" }, + { url = "https://files.pythonhosted.org/packages/d2/b5/a210ea073ea1cfaca1bb5c55a62307d8252f531beb364e18aa1e0888b5a0/kiwisolver-1.4.9-cp314-cp314t-manylinux_2_24_s390x.manylinux_2_28_s390x.whl", hash = "sha256:85bd218b5ecfbee8c8a82e121802dcb519a86044c9c3b2e4aef02fa05c6da370", size = 1453990, upload-time = "2025-08-10T21:27:27.089Z" }, + { url = "https://files.pythonhosted.org/packages/5f/ce/a829eb8c033e977d7ea03ed32fb3c1781b4fa0433fbadfff29e39c676f32/kiwisolver-1.4.9-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:0856e241c2d3df4efef7c04a1e46b1936b6120c9bcf36dd216e3acd84bc4fb21", size = 2331601, upload-time = "2025-08-10T21:27:29.343Z" }, + { url = "https://files.pythonhosted.org/packages/e0/4b/b5e97eb142eb9cd0072dacfcdcd31b1c66dc7352b0f7c7255d339c0edf00/kiwisolver-1.4.9-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:9af39d6551f97d31a4deebeac6f45b156f9755ddc59c07b402c148f5dbb6482a", size = 2422041, upload-time = "2025-08-10T21:27:30.754Z" }, + { url = "https://files.pythonhosted.org/packages/40/be/8eb4cd53e1b85ba4edc3a9321666f12b83113a178845593307a3e7891f44/kiwisolver-1.4.9-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:bb4ae2b57fc1d8cbd1cf7b1d9913803681ffa903e7488012be5b76dedf49297f", size = 2594897, upload-time = "2025-08-10T21:27:32.803Z" }, + { url = "https://files.pythonhosted.org/packages/99/dd/841e9a66c4715477ea0abc78da039832fbb09dac5c35c58dc4c41a407b8a/kiwisolver-1.4.9-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:aedff62918805fb62d43a4aa2ecd4482c380dc76cd31bd7c8878588a61bd0369", size = 2391835, upload-time = "2025-08-10T21:27:34.23Z" }, + { url = "https://files.pythonhosted.org/packages/0c/28/4b2e5c47a0da96896fdfdb006340ade064afa1e63675d01ea5ac222b6d52/kiwisolver-1.4.9-cp314-cp314t-win_amd64.whl", hash = "sha256:1fa333e8b2ce4d9660f2cda9c0e1b6bafcfb2457a9d259faa82289e73ec24891", size = 79988, upload-time = "2025-08-10T21:27:35.587Z" }, + { url = "https://files.pythonhosted.org/packages/80/be/3578e8afd18c88cdf9cb4cffde75a96d2be38c5a903f1ed0ceec061bd09e/kiwisolver-1.4.9-cp314-cp314t-win_arm64.whl", hash = "sha256:4a48a2ce79d65d363597ef7b567ce3d14d68783d2b2263d98db3d9477805ba32", size = 70260, upload-time = "2025-08-10T21:27:36.606Z" }, + { url = "https://files.pythonhosted.org/packages/a3/0f/36d89194b5a32c054ce93e586d4049b6c2c22887b0eb229c61c68afd3078/kiwisolver-1.4.9-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:720e05574713db64c356e86732c0f3c5252818d05f9df320f0ad8380641acea5", size = 60104, upload-time = "2025-08-10T21:27:43.287Z" }, + { url = "https://files.pythonhosted.org/packages/52/ba/4ed75f59e4658fd21fe7dde1fee0ac397c678ec3befba3fe6482d987af87/kiwisolver-1.4.9-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:17680d737d5335b552994a2008fab4c851bcd7de33094a82067ef3a576ff02fa", size = 58592, upload-time = "2025-08-10T21:27:44.314Z" }, + { url = "https://files.pythonhosted.org/packages/33/01/a8ea7c5ea32a9b45ceeaee051a04c8ed4320f5add3c51bfa20879b765b70/kiwisolver-1.4.9-pp311-pypy311_pp73-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:85b5352f94e490c028926ea567fc569c52ec79ce131dadb968d3853e809518c2", size = 80281, upload-time = "2025-08-10T21:27:45.369Z" }, + { url = "https://files.pythonhosted.org/packages/da/e3/dbd2ecdce306f1d07a1aaf324817ee993aab7aee9db47ceac757deabafbe/kiwisolver-1.4.9-pp311-pypy311_pp73-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:464415881e4801295659462c49461a24fb107c140de781d55518c4b80cb6790f", size = 78009, upload-time = "2025-08-10T21:27:46.376Z" }, + { url = "https://files.pythonhosted.org/packages/da/e9/0d4add7873a73e462aeb45c036a2dead2562b825aa46ba326727b3f31016/kiwisolver-1.4.9-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:fb940820c63a9590d31d88b815e7a3aa5915cad3ce735ab45f0c730b39547de1", size = 73929, upload-time = "2025-08-10T21:27:48.236Z" }, +] + +[[package]] +name = "lxml" +version = "6.1.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/05/3b/aab6728cae887456f409b4d75e8a01856e4f04bd510de38052a47768b680/lxml-6.1.1.tar.gz", hash = "sha256:ba96ae44888e0185281e937633a743ea90d5a196c6000f82565ebb0580012d40", size = 4197430, upload-time = "2026-05-18T19:19:06.424Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/62/b0/83f481780d1548750b8ce2ec824073deef2f452d9cd1a6faff8507e3d16d/lxml-6.1.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:53b7d2b7a10b1c35c0a5e21e9224accf60c1bbfba523990732e521b2b73adef2", size = 8526461, upload-time = "2026-05-18T19:17:25.862Z" }, + { url = "https://files.pythonhosted.org/packages/b9/d5/30fa0f808002c7329397bfbb24e306789c0b29f04aa5842c07b174b4216f/lxml-6.1.1-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:ff3f333630ab480244a1bff72043e511a91eb22e7595dead8653ee5612dd8f3d", size = 4595375, upload-time = "2026-05-18T19:17:34.555Z" }, + { url = "https://files.pythonhosted.org/packages/4f/d2/edb71cf0e561581a7c5eb2626244320eb04e9f8ce6d563184fd668b45073/lxml-6.1.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:a4bbea04c97f6d78a48e3fbc1cb9116d2780b1b39e03a23f6eb9b603fd61f510", size = 4923654, upload-time = "2026-05-18T19:17:42.917Z" }, + { url = "https://files.pythonhosted.org/packages/4c/77/1bc7eeb0de4577d783fb625aa092cc9357883bba35845a3666bf1259f3dc/lxml-6.1.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:db1d75f6617a49c1c01bc7023713e0ff59ab32c9579ae62a7674c0e34f3b0b0a", size = 5067921, upload-time = "2026-05-18T19:17:49.175Z" }, + { url = "https://files.pythonhosted.org/packages/1b/3c/c0690d74bd2bc17bc03b5b0d093569ead597dd0bfa088bf99eef8c24e19c/lxml-6.1.1-cp311-cp311-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:3a12689be69a28ddaa0ab99a5a1137da2afd5f8f16df7b5680b66f616d3eda1d", size = 5002456, upload-time = "2026-05-18T19:17:59.715Z" }, + { url = "https://files.pythonhosted.org/packages/66/8d/d1b3271af0c0f1e27e8472a849e4d2c65bc7766884b9ad2da9e76e145c88/lxml-6.1.1-cp311-cp311-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:18b73c339ae29b90fd2d06e58ebd555a751bde9cd6bbd36cc0281b9a2c94e9d8", size = 5202776, upload-time = "2026-05-18T19:18:08.924Z" }, + { url = "https://files.pythonhosted.org/packages/7a/45/689824ffb237fd10125ad273f32b28ff04dc6203c2822c85ff65a93df65e/lxml-6.1.1-cp311-cp311-manylinux_2_28_i686.whl", hash = "sha256:752d3bbfe874715ccd0aec7f88d7fc623c0f1fd7aa7b3238a084e017bad2a009", size = 5329945, upload-time = "2026-05-18T19:18:13.673Z" }, + { url = "https://files.pythonhosted.org/packages/5d/c0/ef73af53767e958fd87d437c170f272e2f6e6c0f854939f133a895f1e711/lxml-6.1.1-cp311-cp311-manylinux_2_31_armv7l.whl", hash = "sha256:6b1761fbf9ec984e2e9d9c589ef5f5fd684b7c19f92aadd567a26c5224958db6", size = 4659237, upload-time = "2026-05-18T19:18:18.657Z" }, + { url = "https://files.pythonhosted.org/packages/a0/5e/e1158e40397585e91cb0472374a1f63d0926a1ddeaa92f13d1a1ffe306d5/lxml-6.1.1-cp311-cp311-manylinux_2_38_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:d680fbcb768404c601ecb43519ecd8461f6954cb11c06a78962f666832ccfca8", size = 5265904, upload-time = "2026-05-18T19:18:24.883Z" }, + { url = "https://files.pythonhosted.org/packages/a0/16/8687e5d1400ed1c0bc41dace232ebb7553952b618ea1f2e5fb6e2cfbbe23/lxml-6.1.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:162af1091cd785f2f27e62d3547ae9bc58ec5c86dd314d67021fd02463708d83", size = 5045225, upload-time = "2026-05-18T19:17:20.073Z" }, + { url = "https://files.pythonhosted.org/packages/ca/18/d877bd1ae2e5ffdfd4836565aba350db31feb2f2656d6ce70316ed66a05e/lxml-6.1.1-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:e9308ff8241c532df3f3e570f9a5aeed6c853f888512ba4b75638d7c11c95ef6", size = 4712721, upload-time = "2026-05-18T19:17:40.512Z" }, + { url = "https://files.pythonhosted.org/packages/44/4d/1f44fd1d770b10dacbf6b5c6e520f4d6e0708744930f719dc04e67cab981/lxml-6.1.1-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:5f6994074ebae6ffb04447268e37dc16edc304f9859cf91acb86e0af6c1b395c", size = 5252549, upload-time = "2026-05-18T19:17:51.236Z" }, + { url = "https://files.pythonhosted.org/packages/64/5d/1d66b84f850089254c230ef6ea6b267a5a54e2e179a5d960036a05d501d7/lxml-6.1.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:80c2dfadb855da477cf73373ad29a333535dedb9b12bad02c9814c8e2b43bf08", size = 5226877, upload-time = "2026-05-18T19:18:00.875Z" }, + { url = "https://files.pythonhosted.org/packages/ad/00/84c4b5302d42a2d0184f38d538c8a197f33b52a50bd4f7bcfe990bce3036/lxml-6.1.1-cp311-cp311-win32.whl", hash = "sha256:30a89d3ac8faec007453fb541f3f46807eeec88edd5826f6e3fe001752a2c621", size = 3594072, upload-time = "2026-05-18T19:17:12.714Z" }, + { url = "https://files.pythonhosted.org/packages/61/9d/2e2f7d876349f45e0f3e29f72da311668853d59b58d473a2dea4f0160135/lxml-6.1.1-cp311-cp311-win_amd64.whl", hash = "sha256:abbefa31eee84842140f67acef1c828e28bba8bbf0c3bc6e5492a9af88152c28", size = 4025469, upload-time = "2026-05-18T19:17:50.566Z" }, + { url = "https://files.pythonhosted.org/packages/b0/d5/570e6390e4110331e6208b2ba83d1482cc9146808ee118b22824a34c1070/lxml-6.1.1-cp311-cp311-win_arm64.whl", hash = "sha256:dcb292aa7fe485ceff7af4f92e46c5af397daec5dff64871a528f0fc47a3cc5b", size = 3667640, upload-time = "2026-05-19T19:22:48.293Z" }, + { url = "https://files.pythonhosted.org/packages/6a/6e/c4add832b6fc1e887125b96f880d7b9b70aae5248718e046b1704bcac4b9/lxml-6.1.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:104c09bda8d2a562824c0e319d0768ce26a779b7601e0931d33b09b53c392ef7", size = 8570821, upload-time = "2026-05-18T19:17:42.068Z" }, + { url = "https://files.pythonhosted.org/packages/22/00/ff3009c88e65de8011630acf8ab5a09cb2becd2aaf47fba2f3449f6224e9/lxml-6.1.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:25c6997a9a534e016695a0ba06b2f07945de682731ff01065b6d5a4474179da1", size = 4624252, upload-time = "2026-05-18T19:17:47.897Z" }, + { url = "https://files.pythonhosted.org/packages/42/95/bb63f0fd62e554fe078e1fb3c8fe9083c14ddc7ad7fa178d10e57e071ac7/lxml-6.1.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:c921ba5c51e4e9f63b8b00267d06566e1f63407408a0496da2d1d0bfc819c7fc", size = 4930746, upload-time = "2026-05-18T19:18:29.637Z" }, + { url = "https://files.pythonhosted.org/packages/eb/99/0013e8d9b5960f4f041cf0b73e2f80c23eb5205b1f7bfb20203243651359/lxml-6.1.1-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:54a7f95e4de5fb94e2f9f4b9055c6ba33bf3d628fd77a1d647c5923caa2cdcdc", size = 5093723, upload-time = "2026-05-18T19:18:34.168Z" }, + { url = "https://files.pythonhosted.org/packages/29/91/317b332636bfc7bddcff828d41b3307f50043f4b237e40849c333d80fa1a/lxml-6.1.1-cp312-cp312-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:96f2ec43df44b1f76249ee0a615334f9b5b060e1c8bd90e706dad2d14d02f383", size = 5005557, upload-time = "2026-05-18T19:18:39.798Z" }, + { url = "https://files.pythonhosted.org/packages/42/2f/cc9bf06afe70f9c9093ae60855d9759da9db601ec4080f7473319666ffd7/lxml-6.1.1-cp312-cp312-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:70ef8a7e102a1508f8121aae5b0867abd663f72c14f0a9c937e6554cb4587b7b", size = 5631036, upload-time = "2026-05-18T19:18:44.858Z" }, + { url = "https://files.pythonhosted.org/packages/08/f6/af32e23e563971ffb0fb86be52bc5be5c2c118858ffc119bf6a9039b173d/lxml-6.1.1-cp312-cp312-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ebe6af670449830d6d9b752c256a983291c766a1365ba5d5460048f9e33a7818", size = 5240367, upload-time = "2026-05-18T19:18:49.217Z" }, + { url = "https://files.pythonhosted.org/packages/78/83/8555d40948b09ce86f1bd0c68a7ac31d07b1929f92cc1b074006c97ef2d2/lxml-6.1.1-cp312-cp312-manylinux_2_28_i686.whl", hash = "sha256:27acc820660aaffa4f7c087f29120e12980f7779d56d8492d263170111284740", size = 5350171, upload-time = "2026-05-18T19:18:52.779Z" }, + { url = "https://files.pythonhosted.org/packages/63/75/5d92da93729b7bad783689e6496049fa40927b45bec7bf183c981de3ca70/lxml-6.1.1-cp312-cp312-manylinux_2_31_armv7l.whl", hash = "sha256:1db753c9115ec7100d073b744d17e25e88a8f90f5c39b2f5dd878149af59671f", size = 4694874, upload-time = "2026-05-18T19:18:55.139Z" }, + { url = "https://files.pythonhosted.org/packages/c5/b5/3aad415a9a25b822e783f15deeb4dffccf5113030f1afa2222dd929313d9/lxml-6.1.1-cp312-cp312-manylinux_2_38_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:c4f469aebd783bb741c2ecb2a681008fd26bfe5c16a9a72ed5467f834e810df2", size = 5244492, upload-time = "2026-05-18T19:19:01.28Z" }, + { url = "https://files.pythonhosted.org/packages/f1/a1/5fcf7eb9904b80086aa47dcf0027de07b1bb990afad2e6823144c368ae04/lxml-6.1.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:766b010012d59470072c1816b5b6c69f1d243e5db36ea5968e94accf430a4635", size = 5048232, upload-time = "2026-05-18T19:18:12.67Z" }, + { url = "https://files.pythonhosted.org/packages/77/74/1f601b63c7a69fcdf10fa9b148c81da8442204194f6c55509cc485c786b9/lxml-6.1.1-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:b8d812c6011c08b8111a15e54dd990b8923692d80adf35488bee34026c35accf", size = 4777023, upload-time = "2026-05-18T19:18:15.928Z" }, + { url = "https://files.pythonhosted.org/packages/a2/b9/7a78f51aec95b1bf780d78e12705a9f6533284f8693dc5c0e6724fa53d3f/lxml-6.1.1-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:fe0306bd29505a9177aac19f1877174b0e7422c222a59f70b2cd41633448c3dc", size = 5645773, upload-time = "2026-05-18T19:18:23.223Z" }, + { url = "https://files.pythonhosted.org/packages/a5/6e/98a7b7ad54e4e74fa1f20fff776913980619d0ebe5558232d7da6580bdd8/lxml-6.1.1-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:5ba186ad207446c65d3bb3d3e0412b032b1d9f595e59861e2354798c5703d955", size = 5233088, upload-time = "2026-05-18T19:18:31.433Z" }, + { url = "https://files.pythonhosted.org/packages/65/d1/bc0ed2427bf609f2ee10da303a6a226f9c8bce94f945dc29a32ce55de6e4/lxml-6.1.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:aa366a1e55b8ebfe8ca8ddc3cfe75c8ebade181aeb0f661d0cb05986b647f72a", size = 5260995, upload-time = "2026-05-18T19:18:37.091Z" }, + { url = "https://files.pythonhosted.org/packages/69/8b/6772e1a4b513fc50a8d931f19edde0e13ae6918510a1e13ff67864f3e5ed/lxml-6.1.1-cp312-cp312-win32.whl", hash = "sha256:126c93f7f56f0eda92f6d8c619edc463a4f23d9252f1c9d0405a76f25fa9f11a", size = 3596382, upload-time = "2026-05-18T19:17:18.37Z" }, + { url = "https://files.pythonhosted.org/packages/1b/89/45198e9624762af2dfd2cb8782598477ceb29f6e59caab560388ae1f4ec1/lxml-6.1.1-cp312-cp312-win_amd64.whl", hash = "sha256:26e6eda8d38c1fcab1090dd196ee87cbd13788e531937610e2589085de074e77", size = 3997255, upload-time = "2026-05-18T19:17:56.781Z" }, + { url = "https://files.pythonhosted.org/packages/90/a9/7a54b6834088d9ae528a7b780584ba6a39a9457b0ac330479f20ffbc9449/lxml-6.1.1-cp312-cp312-win_arm64.whl", hash = "sha256:6540377fbd53fe1b629172288c464fb18db11ce1fa7dc15891da10aa9dcc3e7f", size = 3659610, upload-time = "2026-05-19T19:22:50.843Z" }, + { url = "https://files.pythonhosted.org/packages/a5/eb/7e6f37c5584ccbb2ff267f56fd0339016938c1c8684cfefab9b33ffc2f36/lxml-6.1.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:68a9198d0fc122d14bb76837de9aa80cf84caed990b5b237f532ed87d3706736", size = 8559780, upload-time = "2026-05-18T19:17:57.661Z" }, + { url = "https://files.pythonhosted.org/packages/a1/36/587c2521cf23a2cd6c9c22108aa7528f683a1f195ed7ccd23a4b1786ad36/lxml-6.1.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:7d47866cb32fb503450b6edc9df355d10dc49836af2e89901bd6ac6b0896d9d9", size = 4618006, upload-time = "2026-05-18T19:18:04.452Z" }, + { url = "https://files.pythonhosted.org/packages/6e/ca/ab7bfe2bf4c972af5e7878262845ead3a24a929a9b04bc11c7c1ece6c82a/lxml-6.1.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:eb7c9811bfaa8b1ed5ed319f5d370dfbcaa59d52ea64be2a5a85e18195930354", size = 4924139, upload-time = "2026-05-18T19:19:04.873Z" }, + { url = "https://files.pythonhosted.org/packages/6b/55/a0c72851dfee5ecc689f949723a73dea457758912542cb955b108eaf0d8f/lxml-6.1.1-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:762ff394d5bd56da0cf034a23dcce4e13923f15321a2adfa2ac00201dc6d3fca", size = 5082329, upload-time = "2026-05-18T19:19:09.728Z" }, + { url = "https://files.pythonhosted.org/packages/f0/b6/0608f7d61a3b96cc67e5648a3d906e31a5082093e10e7be65b3886289938/lxml-6.1.1-cp313-cp313-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a088f287f7d8275a33c07f2cac6c50b9319309a0200a39e7e75d80c707723099", size = 4993564, upload-time = "2026-05-18T19:19:13.608Z" }, + { url = "https://files.pythonhosted.org/packages/4c/66/ae227524b066d29d55bf0b453d93d2d793c40218657d643dcbbca13b8faf/lxml-6.1.1-cp313-cp313-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:e902da4b04e6b52e5893900d4b8ab46068f75f3561f01bf1080957f9fd932ed6", size = 5613467, upload-time = "2026-05-18T19:19:16.228Z" }, + { url = "https://files.pythonhosted.org/packages/a6/76/dbe4a00b50385e40194231dcfe5a12c059de7cf90e89c83407d2b085b719/lxml-6.1.1-cp313-cp313-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:1d4962d4c66bf830a7e59ed6cfc17d148149898a3aefa8ec6e59763e6e3ed085", size = 5228304, upload-time = "2026-05-18T19:19:19.354Z" }, + { url = "https://files.pythonhosted.org/packages/1c/01/00b1b8442ed2041793336868ba0b9ea4b13d7da7c085c6404c207a63bf79/lxml-6.1.1-cp313-cp313-manylinux_2_28_i686.whl", hash = "sha256:581d4c8ae690a6609e64862dd6b7c2489635c2d13907fc2b20f2bc200ff1d21e", size = 5341607, upload-time = "2026-05-18T19:19:22.297Z" }, + { url = "https://files.pythonhosted.org/packages/63/36/1ad29931e9a4638bb707869f01d423a6c815f82152138d1a40dfcfde2b95/lxml-6.1.1-cp313-cp313-manylinux_2_31_armv7l.whl", hash = "sha256:876e1ff5930ed8bf295ec5ef9a8155e9b6b1876bbf1deed8b3a8069311875a8f", size = 4700168, upload-time = "2026-05-18T19:19:25.133Z" }, + { url = "https://files.pythonhosted.org/packages/3c/d1/a9536cecf9be18a0dc72d32bead283a2332d1ffebd2dd3ac70ce444686e5/lxml-6.1.1-cp313-cp313-manylinux_2_38_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:9eb9b5a968f6e0f6d640092a567e14529ff8cea2e29d00da6f78a79fa49f013c", size = 5232487, upload-time = "2026-05-18T19:19:28.603Z" }, + { url = "https://files.pythonhosted.org/packages/0e/77/b4fb1e03bf5d130e879214d3100092e386418807fb74dd0adc4b0a48f351/lxml-6.1.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:aa49e06d94aba782c6a02eecb7e507969e7e7a41b267f1b359bb35585f295d5b", size = 5044231, upload-time = "2026-05-18T19:18:42.246Z" }, + { url = "https://files.pythonhosted.org/packages/26/4c/d00daeeb0a5530c4028a9232aa1b93db3ef4ed2158c116ea73c79a9765b3/lxml-6.1.1-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:70cdfd80589d59e43e18005dd7244e8895e93db8ab6a620b7e23df5445a4e3d2", size = 4769450, upload-time = "2026-05-18T19:18:48.013Z" }, + { url = "https://files.pythonhosted.org/packages/ed/6a/715a3a8d156ce42f29cf014706f5410c2ff3b02267774110fc23266409fe/lxml-6.1.1-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:aad9aa39483ed8ec44d6d2e59e5b98a0d80676ef0d92f44bfc374836111f62f5", size = 5635874, upload-time = "2026-05-18T19:18:51.914Z" }, + { url = "https://files.pythonhosted.org/packages/45/37/0544bc21dde2a88f3a17b504e6fc79c0e01d25a33c2f6079724e9e72b9c7/lxml-6.1.1-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:d49514be2f28d895c38cf9d2b72d7b9a07d00314519f456c0b50b53cfcf4c785", size = 5223987, upload-time = "2026-05-18T19:18:59.715Z" }, + { url = "https://files.pythonhosted.org/packages/4d/f8/f6a5e8185bcb28c2befae3d31f8e3df3b811cb0f47746517a81279fcafe1/lxml-6.1.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:47402e62c52ff5988c1e8c6c63177f5708bccf48e366dea4e3dcf1e645e04947", size = 5250276, upload-time = "2026-05-18T19:19:03.834Z" }, + { url = "https://files.pythonhosted.org/packages/c7/f2/1a2b9f1b7a49d45495369be7ef9ad05b262930f2eab3e3145706fca8083f/lxml-6.1.1-cp313-cp313-win32.whl", hash = "sha256:3483644525531e1d5762b0c44a8e18b6efba321b6dcf8a8952de10b037618bca", size = 3596903, upload-time = "2026-05-18T19:17:29.863Z" }, + { url = "https://files.pythonhosted.org/packages/e6/99/f4ffb024f238eec2131aaa09f3278fb6129cf892741bf68e1fc1afb8c100/lxml-6.1.1-cp313-cp313-win_amd64.whl", hash = "sha256:a10bd2fd62e8ce916ececb342f348f190724a098c1faa056fdfb2a22ad5e8660", size = 3995869, upload-time = "2026-05-18T19:18:02.596Z" }, + { url = "https://files.pythonhosted.org/packages/d1/53/70eb8c5c6037f27448f1e3c54ebede9545a801ae63f0a7254afca4fe8e45/lxml-6.1.1-cp313-cp313-win_arm64.whl", hash = "sha256:424aa57aca0897eb922aef34395bd1289b3b6f04e6bae20ea123c0c7e333cffc", size = 3658490, upload-time = "2026-05-19T19:22:53.846Z" }, + { url = "https://files.pythonhosted.org/packages/13/e2/2e325795566de01d0d7c3bb57d3c370616b2d07b01214e84eec5d3b10963/lxml-6.1.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:19b7ab10b210b0b3ad7985d9ac4eb66ab09a90b20fe6e2f7ba55d01a234345d0", size = 8577146, upload-time = "2026-05-18T19:18:17.765Z" }, + { url = "https://files.pythonhosted.org/packages/93/cf/5630b5e4be7d2e6bee8efe83865c925221103cf0221303b104ce134b01e2/lxml-6.1.1-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:c08e5c694306507275f2290073350c4f32e383db15213b2c69e7ff39c1193840", size = 4623866, upload-time = "2026-05-18T19:18:30.669Z" }, + { url = "https://files.pythonhosted.org/packages/d2/51/3904907c063451cf8d4a5c9fe0cad95fa1f4ec57f4e3884fa0731bd7a305/lxml-6.1.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:74a9717fd0d82effef5c2854f0d917231d5324b5a3eb7275c43ac9fa32f97a14", size = 4950022, upload-time = "2026-05-18T19:19:31.958Z" }, + { url = "https://files.pythonhosted.org/packages/94/cd/9c7611a51c37a2830928405817cc5d56a97f64fab83cc3f628748b135749/lxml-6.1.1-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:efe0374196335f93b53269acd811b944f2e6bdc88e8894f214bd636455484909", size = 5086695, upload-time = "2026-05-18T19:19:34.764Z" }, + { url = "https://files.pythonhosted.org/packages/da/d6/24e3b5906abb0b674ff2ae195bc3ce59708df2bcd17cf17703b2d7dd643a/lxml-6.1.1-cp314-cp314-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ac931cdc9442c1763b8a8f6cd62c0c938737eafc5be75eff88df55fc73bc0d00", size = 5031642, upload-time = "2026-05-18T19:19:37.771Z" }, + { url = "https://files.pythonhosted.org/packages/2d/db/6ec54f99019838bff54785c51da07f189eb4676861c5f2730962b0d8d665/lxml-6.1.1-cp314-cp314-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:aee395f5d0927f947758b4ec119fd5fc8ec71f07a1c5c52077b30b04c0fa6955", size = 5647338, upload-time = "2026-05-18T19:19:40.553Z" }, + { url = "https://files.pythonhosted.org/packages/42/3d/ef4dcfffd22d27a61805d8ed9f7fb888495bc6aa88648fa07c1eaa5586b6/lxml-6.1.1-cp314-cp314-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9395002973c827b3ed67db77e6ec09f092919a587022174554096a269378fb13", size = 5239528, upload-time = "2026-05-18T19:19:43.657Z" }, + { url = "https://files.pythonhosted.org/packages/62/bb/37fb3f0dff146bdcfa78eec47879273820b2a0bf350ec236ce14bd0b1c26/lxml-6.1.1-cp314-cp314-manylinux_2_28_i686.whl", hash = "sha256:73bc2086f141224ebddb7fc5c6a36ca58b31b94b561e1dfe8e073e3270fad1e7", size = 5350730, upload-time = "2026-05-18T19:19:46.307Z" }, + { url = "https://files.pythonhosted.org/packages/90/42/43253f168388df4fae1f38c01df36ddb9bee39e2048167b54cdcbae85ea3/lxml-6.1.1-cp314-cp314-manylinux_2_31_armv7l.whl", hash = "sha256:3779def59032b81e44a5f70096ef6bf2082f8d901937dca354474ba09782e245", size = 4697530, upload-time = "2026-05-18T19:19:49.889Z" }, + { url = "https://files.pythonhosted.org/packages/eb/a8/c5a8504f81bbdfc8e7094c2c850cdb4ed6777fc4d5ddd9e5ab819f3b0d54/lxml-6.1.1-cp314-cp314-manylinux_2_38_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:86c89b9d55ebf820ad7c90bc533410f0d098054f293351f10603c0c46ff598f5", size = 5250670, upload-time = "2026-05-18T19:19:53.199Z" }, + { url = "https://files.pythonhosted.org/packages/77/b7/c7e76ab18744d75e21f320ebf9ff9d1ceae2b54dd431ea5a64caf26c9672/lxml-6.1.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:19607c6bbff2a44cf3fe8250abccd20942d3462473e0a721d01d379ed017e462", size = 5084485, upload-time = "2026-05-18T19:19:08.422Z" }, + { url = "https://files.pythonhosted.org/packages/31/31/b35c53f8ef7b7c31cacd23d3638652fff7bcd1deb6eedb709ab43b685908/lxml-6.1.1-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:c6ed5141a5c7507cf3ee76bd363b0d6f801e3321adc35b5d825a23115faa5465", size = 4737635, upload-time = "2026-05-18T19:19:12.321Z" }, + { url = "https://files.pythonhosted.org/packages/d9/06/31f23c813a7fe8e0cb1b175e915b08c9bf4e86d225b210feadbdbe519667/lxml-6.1.1-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:62aeb7e85b5d60320b9d77eef2e773994e2c0ce10121b277e0a19804e1654a5a", size = 5670681, upload-time = "2026-05-18T19:19:15.001Z" }, + { url = "https://files.pythonhosted.org/packages/1a/bc/ce619bccc89b1fd9ad8a8e1330ee3f3beff9f2ff95b712d7bbcdd6e22fc3/lxml-6.1.1-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:b1b963fd8f5caa68e99dfae060d54de1fe9cba899b8718b44a00cdca53c3e590", size = 5238229, upload-time = "2026-05-18T19:19:18.131Z" }, + { url = "https://files.pythonhosted.org/packages/2f/5d/b329acbbedc0b619ebc2be6cf7ee9ed07e80892c88d4dfd612c33805789a/lxml-6.1.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:63876be28efefa04a1df615b46770e82042cce445cfdce55160522f57b231ccb", size = 5264191, upload-time = "2026-05-18T19:19:21.118Z" }, + { url = "https://files.pythonhosted.org/packages/d6/85/be36fb1425b30db3c3f9df75fe86343ebffb79e6320bd7f588e25bfeac39/lxml-6.1.1-cp314-cp314-win32.whl", hash = "sha256:7f7a92e8583f06b1fd49d01158143b8461cfcd135dcb10ec807270a3051bd603", size = 3657202, upload-time = "2026-05-18T19:17:39.509Z" }, + { url = "https://files.pythonhosted.org/packages/b8/ce/3cf9a827342269f54d405a6202397de63f07c69cbd6ce7d183a3f0cba1e9/lxml-6.1.1-cp314-cp314-win_amd64.whl", hash = "sha256:b2d444f2e66624d68e9c6b211e28a76e22fff5fcabcfff4deac18b529b7d4137", size = 4064497, upload-time = "2026-05-18T19:18:14.662Z" }, + { url = "https://files.pythonhosted.org/packages/d9/3e/1a957bde8f0760039e627f94699f82caa782c9d838d86c3d28245ee67212/lxml-6.1.1-cp314-cp314-win_arm64.whl", hash = "sha256:3fd9728a2735fda14f4e8235830c86b539e9661e849665bf926d3f867943b4bf", size = 3741991, upload-time = "2026-05-19T19:22:59.111Z" }, + { url = "https://files.pythonhosted.org/packages/78/b2/00ed55b3a2efa4658fb795c38d1090ec9b3e8a6c3683d4441fa517f09c3b/lxml-6.1.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:787b2496d0dbe8cd180984e8d29e3a6f76e7ea34db781cb3bd55e4ba1ef8b4ee", size = 8827545, upload-time = "2026-05-18T19:18:41.193Z" }, + { url = "https://files.pythonhosted.org/packages/c0/73/74573db19baa618d5f266f2407898b087ff6927115b00b71e5fc1b700847/lxml-6.1.1-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:2c8daa471358dc2d6fcf02165e80ec68f77871a286df95bc5cc3816153b0fd2c", size = 4735736, upload-time = "2026-05-18T19:18:46.761Z" }, + { url = "https://files.pythonhosted.org/packages/16/02/6f7061f4f95f51e545d48e87647c54791d204a4e881be4156e7a26ba5338/lxml-6.1.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:acd7d70b64c0aae0c7922cca83d288a16f5f6da523637697872253415269baef", size = 4970291, upload-time = "2026-05-18T19:19:56.215Z" }, + { url = "https://files.pythonhosted.org/packages/b0/02/55fc057d8283427dea7d6edb102e7a840239c77a64a983d92f62a304c0e9/lxml-6.1.1-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:4f0dd2f01f9f8a89f565d000e03abcf0a13d692a346c8d22f628d49af098777a", size = 5102822, upload-time = "2026-05-18T19:19:59.223Z" }, + { url = "https://files.pythonhosted.org/packages/e4/48/8e1cf78d89d66850121d9255a2a24414c98f775da93b90cf976956c24b14/lxml-6.1.1-cp314-cp314t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:0b7e8a14c8634bf6f7a568634cb395305a6d964aeb5b7ee32248094bed3a7e2c", size = 5027923, upload-time = "2026-05-18T19:20:01.549Z" }, + { url = "https://files.pythonhosted.org/packages/ed/00/0632a0647612c8af24d26997b3b961397daa9d5b2581444805933629a4cb/lxml-6.1.1-cp314-cp314t-manylinux_2_26_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:86281fbdd6a8162756f8d603f37e3435bfa38043adb79c6dc6a2dfee065e7525", size = 5595843, upload-time = "2026-05-18T19:20:03.93Z" }, + { url = "https://files.pythonhosted.org/packages/bc/86/ab008a7dc360711b66858d61c80a5979a70a09f2aa2b05d9698df80b803d/lxml-6.1.1-cp314-cp314t-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:c5d7152ec39ca7c402d8fb9bad86140a15b9503bd0c54484e3f1bbe3dd37ceca", size = 5224515, upload-time = "2026-05-18T19:20:06.381Z" }, + { url = "https://files.pythonhosted.org/packages/75/c6/2702ff375e728e34f56d9a45339a9cf7e4427e917f542225242d63a05afa/lxml-6.1.1-cp314-cp314t-manylinux_2_28_i686.whl", hash = "sha256:88d8cb75b9d82858497a5393e3c63cfbf03035225e4b35a49ed7ccb151e4dc0e", size = 5312511, upload-time = "2026-05-18T19:20:09.308Z" }, + { url = "https://files.pythonhosted.org/packages/b7/57/a5807c98f87a86f10ef9ffab35516df7c0f0c4b6d5d33e9f608ab9c04a31/lxml-6.1.1-cp314-cp314t-manylinux_2_31_armv7l.whl", hash = "sha256:f64ec5397ea6a41fc1b4af0380d79b44a755b5531dcaccd9940fb260dca93038", size = 4639206, upload-time = "2026-05-18T19:20:11.704Z" }, + { url = "https://files.pythonhosted.org/packages/1f/e1/8a0a2c35734812395f4da4eaf33748a7e5705bfb2a58b128da764339d5ec/lxml-6.1.1-cp314-cp314t-manylinux_2_38_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:d34bbf07dbc7ca5970671b1512e928991fb5e9d95365636c9b2d8b4f53af405e", size = 5232404, upload-time = "2026-05-18T19:20:14.064Z" }, + { url = "https://files.pythonhosted.org/packages/c2/e2/0e6a4dd5ad84d01d99aa7bae7cfefd4a760a0e0f8176818241de17d9b6c0/lxml-6.1.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:17e0e18d4ad8adbd0399291bc44845b69d9dd68439a3cdebdf35ff902ec05072", size = 5083769, upload-time = "2026-05-18T19:19:23.758Z" }, + { url = "https://files.pythonhosted.org/packages/a0/7e/161f33d463f6ffc1c7679104b65086dea120080d49dde4d238f015aaee2f/lxml-6.1.1-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:3ab541146f1f6968c462d6c2ac495148e8cdba2f8347700b2141b6ec5a75bf52", size = 4758936, upload-time = "2026-05-18T19:19:27.256Z" }, + { url = "https://files.pythonhosted.org/packages/f1/fb/2369825e3f6ca99305bf9f7b7085fda91c8b0922a89e54d900974aa3ef85/lxml-6.1.1-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:2a0217714657e023ef4293500f65aa20fce6164c8fd6b08fa5bd4a859fb14b9b", size = 5620296, upload-time = "2026-05-18T19:19:29.993Z" }, + { url = "https://files.pythonhosted.org/packages/30/90/d61e383146f74c5ab683947ea14dc7b82778838ab9b95ea73a23b60d0191/lxml-6.1.1-cp314-cp314t-musllinux_1_2_riscv64.whl", hash = "sha256:05a82eb6e1530a64f26225b55cbd178113bd0b5af1c2b625f25e5296742c26d2", size = 5228598, upload-time = "2026-05-18T19:19:33.523Z" }, + { url = "https://files.pythonhosted.org/packages/76/2d/2dafd8149e94b05bb070690efd5bb2680720681e03ff03fc57d2b70a1105/lxml-6.1.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:9e36f163528fc50cbef305f02a5fd66d404edf7049cdaff211dbc2cba5a7013e", size = 5247845, upload-time = "2026-05-18T19:19:36.649Z" }, + { url = "https://files.pythonhosted.org/packages/ce/68/b30e913340c380ddac9580c6e6230991fc37240ec4f64704833e4f3e2769/lxml-6.1.1-cp314-cp314t-win32.whl", hash = "sha256:649dda677cf3bd6ac9ae14007ba0c824ded8ce5808b53fc7431d9140399118c1", size = 3897345, upload-time = "2026-05-18T19:17:33.562Z" }, + { url = "https://files.pythonhosted.org/packages/3c/4e/9eb2af5335545f9fbcd7af57bcf87c6025d31eaa31b14ec184a6c8675328/lxml-6.1.1-cp314-cp314t-win_amd64.whl", hash = "sha256:793033d6c5cdf33a573f910d9bea14ef8f5771820411d118da8e1182edb53d5e", size = 4393350, upload-time = "2026-05-18T19:18:10.076Z" }, + { url = "https://files.pythonhosted.org/packages/7f/2c/0f1e93c636720e8a3eb59af2bfda99d98b55891e1c53bc30c2e0e865f01b/lxml-6.1.1-cp314-cp314t-win_arm64.whl", hash = "sha256:58bb955caba94e467d2a96da17660d2d704e0675894cba21ab8a775b8621fd1c", size = 3817223, upload-time = "2026-05-19T19:22:56.823Z" }, + { url = "https://files.pythonhosted.org/packages/b5/32/86a3f0f724a3a402d4627937a7fc27b160e45e7012b4adf47f6e1e844511/lxml-6.1.1-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:31033dc34636ea6b7d5cc11b1ddbda78a14de858ba9d3e1ed4b69a3085bc521e", size = 3930127, upload-time = "2026-05-18T19:19:02.27Z" }, + { url = "https://files.pythonhosted.org/packages/40/44/d832e82af08723761556d004b1d04d281c09f9a8cecd7d3148548c9941a3/lxml-6.1.1-pp311-pypy311_pp73-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:3893c14c4b6ac5b2d54ba8cf03e99fe5104e592de491f19bd6b82756c09f8004", size = 4210769, upload-time = "2026-05-18T19:20:41.427Z" }, + { url = "https://files.pythonhosted.org/packages/6d/39/0dc5949f759ed7d951e0bb8c2f2d9d7aca1908d22352fa84a8afd2ea54af/lxml-6.1.1-pp311-pypy311_pp73-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:c07da4cebf6889f03ebac8d238f62318e29f495de0aa18a51ea14e61ae907e2e", size = 4318163, upload-time = "2026-05-18T19:20:44.702Z" }, + { url = "https://files.pythonhosted.org/packages/e6/fb/8ab3845fe046ba4cbf74536bcf6801a774b7caf4350de1c5d37f1f0a9e90/lxml-6.1.1-pp311-pypy311_pp73-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:f6f0ce10945fab9c4c06ce14e22af9059d1a87493a9af4501a5b0b9187e21cf2", size = 4250945, upload-time = "2026-05-18T19:20:47.385Z" }, + { url = "https://files.pythonhosted.org/packages/68/1b/7553ab136894374ffae8851ec06f98f511cd8e66246e41b6be059d0a7289/lxml-6.1.1-pp311-pypy311_pp73-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:f8844cd288697c6425c9beba919302241e3278871dc6519515e72b04e987abcf", size = 4401664, upload-time = "2026-05-18T19:20:50.489Z" }, + { url = "https://files.pythonhosted.org/packages/db/a4/441aee36c6f6b249823d20fd91f9be9ab89d7c5a8ae542a4a4ca6d342d56/lxml-6.1.1-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:ed21202aec73cda4d55d1ce57b389aadb90ffb044e6cd1080b8347efe1b1ec84", size = 3508989, upload-time = "2026-05-18T19:18:38.158Z" }, +] + +[[package]] +name = "lxml-html-clean" +version = "0.4.5" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "lxml" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/0a/63/195dfdde380a84df309e3bccf4384b034b745dba43426886f7ae623b4fba/lxml_html_clean-0.4.5.tar.gz", hash = "sha256:e2a4c7d5beedd17cd7b484d848a0571e54baa239a4f9df5546e3acba7f990560", size = 24142, upload-time = "2026-05-20T12:17:53.574Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/6a/bd/6e2b76a6c5dee10397db9c929f0c5066766ec1036046f0335b7ca7ca08b8/lxml_html_clean-0.4.5-py3-none-any.whl", hash = "sha256:c76fcadd1e5bfb9b8bafc2200d51e4e78eb0dad67f56881c21dfb6484c7e7746", size = 14573, upload-time = "2026-05-20T12:17:52.215Z" }, +] + +[[package]] +name = "macholib" +version = "1.16.4" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "altgraph", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/10/2f/97589876ea967487978071c9042518d28b958d87b17dceb7cdc1d881f963/macholib-1.16.4.tar.gz", hash = "sha256:f408c93ab2e995cd2c46e34fe328b130404be143469e41bc366c807448979362", size = 59427, upload-time = "2025-11-22T08:28:38.373Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c7/d1/a9f36f8ecdf0fb7c9b1e78c8d7af12b8c8754e74851ac7b94a8305540fc7/macholib-1.16.4-py2.py3-none-any.whl", hash = "sha256:da1a3fa8266e30f0ce7e97c6a54eefaae8edd1e5f86f3eb8b95457cae90265ea", size = 38117, upload-time = "2025-11-22T08:28:36.939Z" }, +] + +[[package]] +name = "markdown-it-py" +version = "4.0.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "mdurl" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/5b/f5/4ec618ed16cc4f8fb3b701563655a69816155e79e24a17b651541804721d/markdown_it_py-4.0.0.tar.gz", hash = "sha256:cb0a2b4aa34f932c007117b194e945bd74e0ec24133ceb5bac59009cda1cb9f3", size = 73070, upload-time = "2025-08-11T12:57:52.854Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/94/54/e7d793b573f298e1c9013b8c4dade17d481164aa517d1d7148619c2cedbf/markdown_it_py-4.0.0-py3-none-any.whl", hash = "sha256:87327c59b172c5011896038353a81343b6754500a08cd7a4973bb48c6d578147", size = 87321, upload-time = "2025-08-11T12:57:51.923Z" }, +] + +[[package]] +name = "markdown2" +version = "2.5.5" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/e4/ae/07d4a5fcaa5509221287d289323d75ac8eda5a5a4ac9de2accf7bbcc2b88/markdown2-2.5.5.tar.gz", hash = "sha256:001547e68f6e7fcf0f1cb83f7e82f48aa7d48b2c6a321f0cd20a853a8a2d1664", size = 157249, upload-time = "2026-03-02T20:46:53.411Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/43/af/4b3891eb0a49d6cfd5cbf3e9bf514c943afc2b0f13e2c57cc57cd88ecc21/markdown2-2.5.5-py3-none-any.whl", hash = "sha256:be798587e09d1f52d2e4d96a649c4b82a778c75f9929aad52a2c95747fa26941", size = 56250, upload-time = "2026-03-02T20:46:52.032Z" }, +] + +[[package]] +name = "markupsafe" +version = "3.0.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/7e/99/7690b6d4034fffd95959cbe0c02de8deb3098cc577c67bb6a24fe5d7caa7/markupsafe-3.0.3.tar.gz", hash = "sha256:722695808f4b6457b320fdc131280796bdceb04ab50fe1795cd540799ebe1698", size = 80313, upload-time = "2025-09-27T18:37:40.426Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/08/db/fefacb2136439fc8dd20e797950e749aa1f4997ed584c62cfb8ef7c2be0e/markupsafe-3.0.3-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:1cc7ea17a6824959616c525620e387f6dd30fec8cb44f649e31712db02123dad", size = 11631, upload-time = "2025-09-27T18:36:18.185Z" }, + { url = "https://files.pythonhosted.org/packages/e1/2e/5898933336b61975ce9dc04decbc0a7f2fee78c30353c5efba7f2d6ff27a/markupsafe-3.0.3-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:4bd4cd07944443f5a265608cc6aab442e4f74dff8088b0dfc8238647b8f6ae9a", size = 12058, upload-time = "2025-09-27T18:36:19.444Z" }, + { url = "https://files.pythonhosted.org/packages/1d/09/adf2df3699d87d1d8184038df46a9c80d78c0148492323f4693df54e17bb/markupsafe-3.0.3-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6b5420a1d9450023228968e7e6a9ce57f65d148ab56d2313fcd589eee96a7a50", size = 24287, upload-time = "2025-09-27T18:36:20.768Z" }, + { url = "https://files.pythonhosted.org/packages/30/ac/0273f6fcb5f42e314c6d8cd99effae6a5354604d461b8d392b5ec9530a54/markupsafe-3.0.3-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:0bf2a864d67e76e5c9a34dc26ec616a66b9888e25e7b9460e1c76d3293bd9dbf", size = 22940, upload-time = "2025-09-27T18:36:22.249Z" }, + { url = "https://files.pythonhosted.org/packages/19/ae/31c1be199ef767124c042c6c3e904da327a2f7f0cd63a0337e1eca2967a8/markupsafe-3.0.3-cp311-cp311-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:bc51efed119bc9cfdf792cdeaa4d67e8f6fcccab66ed4bfdd6bde3e59bfcbb2f", size = 21887, upload-time = "2025-09-27T18:36:23.535Z" }, + { url = "https://files.pythonhosted.org/packages/b2/76/7edcab99d5349a4532a459e1fe64f0b0467a3365056ae550d3bcf3f79e1e/markupsafe-3.0.3-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:068f375c472b3e7acbe2d5318dea141359e6900156b5b2ba06a30b169086b91a", size = 23692, upload-time = "2025-09-27T18:36:24.823Z" }, + { url = "https://files.pythonhosted.org/packages/a4/28/6e74cdd26d7514849143d69f0bf2399f929c37dc2b31e6829fd2045b2765/markupsafe-3.0.3-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:7be7b61bb172e1ed687f1754f8e7484f1c8019780f6f6b0786e76bb01c2ae115", size = 21471, upload-time = "2025-09-27T18:36:25.95Z" }, + { url = "https://files.pythonhosted.org/packages/62/7e/a145f36a5c2945673e590850a6f8014318d5577ed7e5920a4b3448e0865d/markupsafe-3.0.3-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:f9e130248f4462aaa8e2552d547f36ddadbeaa573879158d721bbd33dfe4743a", size = 22923, upload-time = "2025-09-27T18:36:27.109Z" }, + { url = "https://files.pythonhosted.org/packages/0f/62/d9c46a7f5c9adbeeeda52f5b8d802e1094e9717705a645efc71b0913a0a8/markupsafe-3.0.3-cp311-cp311-win32.whl", hash = "sha256:0db14f5dafddbb6d9208827849fad01f1a2609380add406671a26386cdf15a19", size = 14572, upload-time = "2025-09-27T18:36:28.045Z" }, + { url = "https://files.pythonhosted.org/packages/83/8a/4414c03d3f891739326e1783338e48fb49781cc915b2e0ee052aa490d586/markupsafe-3.0.3-cp311-cp311-win_amd64.whl", hash = "sha256:de8a88e63464af587c950061a5e6a67d3632e36df62b986892331d4620a35c01", size = 15077, upload-time = "2025-09-27T18:36:29.025Z" }, + { url = "https://files.pythonhosted.org/packages/35/73/893072b42e6862f319b5207adc9ae06070f095b358655f077f69a35601f0/markupsafe-3.0.3-cp311-cp311-win_arm64.whl", hash = "sha256:3b562dd9e9ea93f13d53989d23a7e775fdfd1066c33494ff43f5418bc8c58a5c", size = 13876, upload-time = "2025-09-27T18:36:29.954Z" }, + { url = "https://files.pythonhosted.org/packages/5a/72/147da192e38635ada20e0a2e1a51cf8823d2119ce8883f7053879c2199b5/markupsafe-3.0.3-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:d53197da72cc091b024dd97249dfc7794d6a56530370992a5e1a08983ad9230e", size = 11615, upload-time = "2025-09-27T18:36:30.854Z" }, + { url = "https://files.pythonhosted.org/packages/9a/81/7e4e08678a1f98521201c3079f77db69fb552acd56067661f8c2f534a718/markupsafe-3.0.3-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:1872df69a4de6aead3491198eaf13810b565bdbeec3ae2dc8780f14458ec73ce", size = 12020, upload-time = "2025-09-27T18:36:31.971Z" }, + { url = "https://files.pythonhosted.org/packages/1e/2c/799f4742efc39633a1b54a92eec4082e4f815314869865d876824c257c1e/markupsafe-3.0.3-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:3a7e8ae81ae39e62a41ec302f972ba6ae23a5c5396c8e60113e9066ef893da0d", size = 24332, upload-time = "2025-09-27T18:36:32.813Z" }, + { url = "https://files.pythonhosted.org/packages/3c/2e/8d0c2ab90a8c1d9a24f0399058ab8519a3279d1bd4289511d74e909f060e/markupsafe-3.0.3-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:d6dd0be5b5b189d31db7cda48b91d7e0a9795f31430b7f271219ab30f1d3ac9d", size = 22947, upload-time = "2025-09-27T18:36:33.86Z" }, + { url = "https://files.pythonhosted.org/packages/2c/54/887f3092a85238093a0b2154bd629c89444f395618842e8b0c41783898ea/markupsafe-3.0.3-cp312-cp312-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:94c6f0bb423f739146aec64595853541634bde58b2135f27f61c1ffd1cd4d16a", size = 21962, upload-time = "2025-09-27T18:36:35.099Z" }, + { url = "https://files.pythonhosted.org/packages/c9/2f/336b8c7b6f4a4d95e91119dc8521402461b74a485558d8f238a68312f11c/markupsafe-3.0.3-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:be8813b57049a7dc738189df53d69395eba14fb99345e0a5994914a3864c8a4b", size = 23760, upload-time = "2025-09-27T18:36:36.001Z" }, + { url = "https://files.pythonhosted.org/packages/32/43/67935f2b7e4982ffb50a4d169b724d74b62a3964bc1a9a527f5ac4f1ee2b/markupsafe-3.0.3-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:83891d0e9fb81a825d9a6d61e3f07550ca70a076484292a70fde82c4b807286f", size = 21529, upload-time = "2025-09-27T18:36:36.906Z" }, + { url = "https://files.pythonhosted.org/packages/89/e0/4486f11e51bbba8b0c041098859e869e304d1c261e59244baa3d295d47b7/markupsafe-3.0.3-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:77f0643abe7495da77fb436f50f8dab76dbc6e5fd25d39589a0f1fe6548bfa2b", size = 23015, upload-time = "2025-09-27T18:36:37.868Z" }, + { url = "https://files.pythonhosted.org/packages/2f/e1/78ee7a023dac597a5825441ebd17170785a9dab23de95d2c7508ade94e0e/markupsafe-3.0.3-cp312-cp312-win32.whl", hash = "sha256:d88b440e37a16e651bda4c7c2b930eb586fd15ca7406cb39e211fcff3bf3017d", size = 14540, upload-time = "2025-09-27T18:36:38.761Z" }, + { url = "https://files.pythonhosted.org/packages/aa/5b/bec5aa9bbbb2c946ca2733ef9c4ca91c91b6a24580193e891b5f7dbe8e1e/markupsafe-3.0.3-cp312-cp312-win_amd64.whl", hash = "sha256:26a5784ded40c9e318cfc2bdb30fe164bdb8665ded9cd64d500a34fb42067b1c", size = 15105, upload-time = "2025-09-27T18:36:39.701Z" }, + { url = "https://files.pythonhosted.org/packages/e5/f1/216fc1bbfd74011693a4fd837e7026152e89c4bcf3e77b6692fba9923123/markupsafe-3.0.3-cp312-cp312-win_arm64.whl", hash = "sha256:35add3b638a5d900e807944a078b51922212fb3dedb01633a8defc4b01a3c85f", size = 13906, upload-time = "2025-09-27T18:36:40.689Z" }, + { url = "https://files.pythonhosted.org/packages/38/2f/907b9c7bbba283e68f20259574b13d005c121a0fa4c175f9bed27c4597ff/markupsafe-3.0.3-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:e1cf1972137e83c5d4c136c43ced9ac51d0e124706ee1c8aa8532c1287fa8795", size = 11622, upload-time = "2025-09-27T18:36:41.777Z" }, + { url = "https://files.pythonhosted.org/packages/9c/d9/5f7756922cdd676869eca1c4e3c0cd0df60ed30199ffd775e319089cb3ed/markupsafe-3.0.3-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:116bb52f642a37c115f517494ea5feb03889e04df47eeff5b130b1808ce7c219", size = 12029, upload-time = "2025-09-27T18:36:43.257Z" }, + { url = "https://files.pythonhosted.org/packages/00/07/575a68c754943058c78f30db02ee03a64b3c638586fba6a6dd56830b30a3/markupsafe-3.0.3-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:133a43e73a802c5562be9bbcd03d090aa5a1fe899db609c29e8c8d815c5f6de6", size = 24374, upload-time = "2025-09-27T18:36:44.508Z" }, + { url = "https://files.pythonhosted.org/packages/a9/21/9b05698b46f218fc0e118e1f8168395c65c8a2c750ae2bab54fc4bd4e0e8/markupsafe-3.0.3-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ccfcd093f13f0f0b7fdd0f198b90053bf7b2f02a3927a30e63f3ccc9df56b676", size = 22980, upload-time = "2025-09-27T18:36:45.385Z" }, + { url = "https://files.pythonhosted.org/packages/7f/71/544260864f893f18b6827315b988c146b559391e6e7e8f7252839b1b846a/markupsafe-3.0.3-cp313-cp313-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:509fa21c6deb7a7a273d629cf5ec029bc209d1a51178615ddf718f5918992ab9", size = 21990, upload-time = "2025-09-27T18:36:46.916Z" }, + { url = "https://files.pythonhosted.org/packages/c2/28/b50fc2f74d1ad761af2f5dcce7492648b983d00a65b8c0e0cb457c82ebbe/markupsafe-3.0.3-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:a4afe79fb3de0b7097d81da19090f4df4f8d3a2b3adaa8764138aac2e44f3af1", size = 23784, upload-time = "2025-09-27T18:36:47.884Z" }, + { url = "https://files.pythonhosted.org/packages/ed/76/104b2aa106a208da8b17a2fb72e033a5a9d7073c68f7e508b94916ed47a9/markupsafe-3.0.3-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:795e7751525cae078558e679d646ae45574b47ed6e7771863fcc079a6171a0fc", size = 21588, upload-time = "2025-09-27T18:36:48.82Z" }, + { url = "https://files.pythonhosted.org/packages/b5/99/16a5eb2d140087ebd97180d95249b00a03aa87e29cc224056274f2e45fd6/markupsafe-3.0.3-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:8485f406a96febb5140bfeca44a73e3ce5116b2501ac54fe953e488fb1d03b12", size = 23041, upload-time = "2025-09-27T18:36:49.797Z" }, + { url = "https://files.pythonhosted.org/packages/19/bc/e7140ed90c5d61d77cea142eed9f9c303f4c4806f60a1044c13e3f1471d0/markupsafe-3.0.3-cp313-cp313-win32.whl", hash = "sha256:bdd37121970bfd8be76c5fb069c7751683bdf373db1ed6c010162b2a130248ed", size = 14543, upload-time = "2025-09-27T18:36:51.584Z" }, + { url = "https://files.pythonhosted.org/packages/05/73/c4abe620b841b6b791f2edc248f556900667a5a1cf023a6646967ae98335/markupsafe-3.0.3-cp313-cp313-win_amd64.whl", hash = "sha256:9a1abfdc021a164803f4d485104931fb8f8c1efd55bc6b748d2f5774e78b62c5", size = 15113, upload-time = "2025-09-27T18:36:52.537Z" }, + { url = "https://files.pythonhosted.org/packages/f0/3a/fa34a0f7cfef23cf9500d68cb7c32dd64ffd58a12b09225fb03dd37d5b80/markupsafe-3.0.3-cp313-cp313-win_arm64.whl", hash = "sha256:7e68f88e5b8799aa49c85cd116c932a1ac15caaa3f5db09087854d218359e485", size = 13911, upload-time = "2025-09-27T18:36:53.513Z" }, + { url = "https://files.pythonhosted.org/packages/e4/d7/e05cd7efe43a88a17a37b3ae96e79a19e846f3f456fe79c57ca61356ef01/markupsafe-3.0.3-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:218551f6df4868a8d527e3062d0fb968682fe92054e89978594c28e642c43a73", size = 11658, upload-time = "2025-09-27T18:36:54.819Z" }, + { url = "https://files.pythonhosted.org/packages/99/9e/e412117548182ce2148bdeacdda3bb494260c0b0184360fe0d56389b523b/markupsafe-3.0.3-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:3524b778fe5cfb3452a09d31e7b5adefeea8c5be1d43c4f810ba09f2ceb29d37", size = 12066, upload-time = "2025-09-27T18:36:55.714Z" }, + { url = "https://files.pythonhosted.org/packages/bc/e6/fa0ffcda717ef64a5108eaa7b4f5ed28d56122c9a6d70ab8b72f9f715c80/markupsafe-3.0.3-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4e885a3d1efa2eadc93c894a21770e4bc67899e3543680313b09f139e149ab19", size = 25639, upload-time = "2025-09-27T18:36:56.908Z" }, + { url = "https://files.pythonhosted.org/packages/96/ec/2102e881fe9d25fc16cb4b25d5f5cde50970967ffa5dddafdb771237062d/markupsafe-3.0.3-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8709b08f4a89aa7586de0aadc8da56180242ee0ada3999749b183aa23df95025", size = 23569, upload-time = "2025-09-27T18:36:57.913Z" }, + { url = "https://files.pythonhosted.org/packages/4b/30/6f2fce1f1f205fc9323255b216ca8a235b15860c34b6798f810f05828e32/markupsafe-3.0.3-cp313-cp313t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:b8512a91625c9b3da6f127803b166b629725e68af71f8184ae7e7d54686a56d6", size = 23284, upload-time = "2025-09-27T18:36:58.833Z" }, + { url = "https://files.pythonhosted.org/packages/58/47/4a0ccea4ab9f5dcb6f79c0236d954acb382202721e704223a8aafa38b5c8/markupsafe-3.0.3-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:9b79b7a16f7fedff2495d684f2b59b0457c3b493778c9eed31111be64d58279f", size = 24801, upload-time = "2025-09-27T18:36:59.739Z" }, + { url = "https://files.pythonhosted.org/packages/6a/70/3780e9b72180b6fecb83a4814d84c3bf4b4ae4bf0b19c27196104149734c/markupsafe-3.0.3-cp313-cp313t-musllinux_1_2_riscv64.whl", hash = "sha256:12c63dfb4a98206f045aa9563db46507995f7ef6d83b2f68eda65c307c6829eb", size = 22769, upload-time = "2025-09-27T18:37:00.719Z" }, + { url = "https://files.pythonhosted.org/packages/98/c5/c03c7f4125180fc215220c035beac6b9cb684bc7a067c84fc69414d315f5/markupsafe-3.0.3-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:8f71bc33915be5186016f675cd83a1e08523649b0e33efdb898db577ef5bb009", size = 23642, upload-time = "2025-09-27T18:37:01.673Z" }, + { url = "https://files.pythonhosted.org/packages/80/d6/2d1b89f6ca4bff1036499b1e29a1d02d282259f3681540e16563f27ebc23/markupsafe-3.0.3-cp313-cp313t-win32.whl", hash = "sha256:69c0b73548bc525c8cb9a251cddf1931d1db4d2258e9599c28c07ef3580ef354", size = 14612, upload-time = "2025-09-27T18:37:02.639Z" }, + { url = "https://files.pythonhosted.org/packages/2b/98/e48a4bfba0a0ffcf9925fe2d69240bfaa19c6f7507b8cd09c70684a53c1e/markupsafe-3.0.3-cp313-cp313t-win_amd64.whl", hash = "sha256:1b4b79e8ebf6b55351f0d91fe80f893b4743f104bff22e90697db1590e47a218", size = 15200, upload-time = "2025-09-27T18:37:03.582Z" }, + { url = "https://files.pythonhosted.org/packages/0e/72/e3cc540f351f316e9ed0f092757459afbc595824ca724cbc5a5d4263713f/markupsafe-3.0.3-cp313-cp313t-win_arm64.whl", hash = "sha256:ad2cf8aa28b8c020ab2fc8287b0f823d0a7d8630784c31e9ee5edea20f406287", size = 13973, upload-time = "2025-09-27T18:37:04.929Z" }, + { url = "https://files.pythonhosted.org/packages/33/8a/8e42d4838cd89b7dde187011e97fe6c3af66d8c044997d2183fbd6d31352/markupsafe-3.0.3-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:eaa9599de571d72e2daf60164784109f19978b327a3910d3e9de8c97b5b70cfe", size = 11619, upload-time = "2025-09-27T18:37:06.342Z" }, + { url = "https://files.pythonhosted.org/packages/b5/64/7660f8a4a8e53c924d0fa05dc3a55c9cee10bbd82b11c5afb27d44b096ce/markupsafe-3.0.3-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:c47a551199eb8eb2121d4f0f15ae0f923d31350ab9280078d1e5f12b249e0026", size = 12029, upload-time = "2025-09-27T18:37:07.213Z" }, + { url = "https://files.pythonhosted.org/packages/da/ef/e648bfd021127bef5fa12e1720ffed0c6cbb8310c8d9bea7266337ff06de/markupsafe-3.0.3-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:f34c41761022dd093b4b6896d4810782ffbabe30f2d443ff5f083e0cbbb8c737", size = 24408, upload-time = "2025-09-27T18:37:09.572Z" }, + { url = "https://files.pythonhosted.org/packages/41/3c/a36c2450754618e62008bf7435ccb0f88053e07592e6028a34776213d877/markupsafe-3.0.3-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:457a69a9577064c05a97c41f4e65148652db078a3a509039e64d3467b9e7ef97", size = 23005, upload-time = "2025-09-27T18:37:10.58Z" }, + { url = "https://files.pythonhosted.org/packages/bc/20/b7fdf89a8456b099837cd1dc21974632a02a999ec9bf7ca3e490aacd98e7/markupsafe-3.0.3-cp314-cp314-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:e8afc3f2ccfa24215f8cb28dcf43f0113ac3c37c2f0f0806d8c70e4228c5cf4d", size = 22048, upload-time = "2025-09-27T18:37:11.547Z" }, + { url = "https://files.pythonhosted.org/packages/9a/a7/591f592afdc734f47db08a75793a55d7fbcc6902a723ae4cfbab61010cc5/markupsafe-3.0.3-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:ec15a59cf5af7be74194f7ab02d0f59a62bdcf1a537677ce67a2537c9b87fcda", size = 23821, upload-time = "2025-09-27T18:37:12.48Z" }, + { url = "https://files.pythonhosted.org/packages/7d/33/45b24e4f44195b26521bc6f1a82197118f74df348556594bd2262bda1038/markupsafe-3.0.3-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:0eb9ff8191e8498cca014656ae6b8d61f39da5f95b488805da4bb029cccbfbaf", size = 21606, upload-time = "2025-09-27T18:37:13.485Z" }, + { url = "https://files.pythonhosted.org/packages/ff/0e/53dfaca23a69fbfbbf17a4b64072090e70717344c52eaaaa9c5ddff1e5f0/markupsafe-3.0.3-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:2713baf880df847f2bece4230d4d094280f4e67b1e813eec43b4c0e144a34ffe", size = 23043, upload-time = "2025-09-27T18:37:14.408Z" }, + { url = "https://files.pythonhosted.org/packages/46/11/f333a06fc16236d5238bfe74daccbca41459dcd8d1fa952e8fbd5dccfb70/markupsafe-3.0.3-cp314-cp314-win32.whl", hash = "sha256:729586769a26dbceff69f7a7dbbf59ab6572b99d94576a5592625d5b411576b9", size = 14747, upload-time = "2025-09-27T18:37:15.36Z" }, + { url = "https://files.pythonhosted.org/packages/28/52/182836104b33b444e400b14f797212f720cbc9ed6ba34c800639d154e821/markupsafe-3.0.3-cp314-cp314-win_amd64.whl", hash = "sha256:bdc919ead48f234740ad807933cdf545180bfbe9342c2bb451556db2ed958581", size = 15341, upload-time = "2025-09-27T18:37:16.496Z" }, + { url = "https://files.pythonhosted.org/packages/6f/18/acf23e91bd94fd7b3031558b1f013adfa21a8e407a3fdb32745538730382/markupsafe-3.0.3-cp314-cp314-win_arm64.whl", hash = "sha256:5a7d5dc5140555cf21a6fefbdbf8723f06fcd2f63ef108f2854de715e4422cb4", size = 14073, upload-time = "2025-09-27T18:37:17.476Z" }, + { url = "https://files.pythonhosted.org/packages/3c/f0/57689aa4076e1b43b15fdfa646b04653969d50cf30c32a102762be2485da/markupsafe-3.0.3-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:1353ef0c1b138e1907ae78e2f6c63ff67501122006b0f9abad68fda5f4ffc6ab", size = 11661, upload-time = "2025-09-27T18:37:18.453Z" }, + { url = "https://files.pythonhosted.org/packages/89/c3/2e67a7ca217c6912985ec766c6393b636fb0c2344443ff9d91404dc4c79f/markupsafe-3.0.3-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:1085e7fbddd3be5f89cc898938f42c0b3c711fdcb37d75221de2666af647c175", size = 12069, upload-time = "2025-09-27T18:37:19.332Z" }, + { url = "https://files.pythonhosted.org/packages/f0/00/be561dce4e6ca66b15276e184ce4b8aec61fe83662cce2f7d72bd3249d28/markupsafe-3.0.3-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:1b52b4fb9df4eb9ae465f8d0c228a00624de2334f216f178a995ccdcf82c4634", size = 25670, upload-time = "2025-09-27T18:37:20.245Z" }, + { url = "https://files.pythonhosted.org/packages/50/09/c419f6f5a92e5fadde27efd190eca90f05e1261b10dbd8cbcb39cd8ea1dc/markupsafe-3.0.3-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:fed51ac40f757d41b7c48425901843666a6677e3e8eb0abcff09e4ba6e664f50", size = 23598, upload-time = "2025-09-27T18:37:21.177Z" }, + { url = "https://files.pythonhosted.org/packages/22/44/a0681611106e0b2921b3033fc19bc53323e0b50bc70cffdd19f7d679bb66/markupsafe-3.0.3-cp314-cp314t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:f190daf01f13c72eac4efd5c430a8de82489d9cff23c364c3ea822545032993e", size = 23261, upload-time = "2025-09-27T18:37:22.167Z" }, + { url = "https://files.pythonhosted.org/packages/5f/57/1b0b3f100259dc9fffe780cfb60d4be71375510e435efec3d116b6436d43/markupsafe-3.0.3-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:e56b7d45a839a697b5eb268c82a71bd8c7f6c94d6fd50c3d577fa39a9f1409f5", size = 24835, upload-time = "2025-09-27T18:37:23.296Z" }, + { url = "https://files.pythonhosted.org/packages/26/6a/4bf6d0c97c4920f1597cc14dd720705eca0bf7c787aebc6bb4d1bead5388/markupsafe-3.0.3-cp314-cp314t-musllinux_1_2_riscv64.whl", hash = "sha256:f3e98bb3798ead92273dc0e5fd0f31ade220f59a266ffd8a4f6065e0a3ce0523", size = 22733, upload-time = "2025-09-27T18:37:24.237Z" }, + { url = "https://files.pythonhosted.org/packages/14/c7/ca723101509b518797fedc2fdf79ba57f886b4aca8a7d31857ba3ee8281f/markupsafe-3.0.3-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:5678211cb9333a6468fb8d8be0305520aa073f50d17f089b5b4b477ea6e67fdc", size = 23672, upload-time = "2025-09-27T18:37:25.271Z" }, + { url = "https://files.pythonhosted.org/packages/fb/df/5bd7a48c256faecd1d36edc13133e51397e41b73bb77e1a69deab746ebac/markupsafe-3.0.3-cp314-cp314t-win32.whl", hash = "sha256:915c04ba3851909ce68ccc2b8e2cd691618c4dc4c4232fb7982bca3f41fd8c3d", size = 14819, upload-time = "2025-09-27T18:37:26.285Z" }, + { url = "https://files.pythonhosted.org/packages/1a/8a/0402ba61a2f16038b48b39bccca271134be00c5c9f0f623208399333c448/markupsafe-3.0.3-cp314-cp314t-win_amd64.whl", hash = "sha256:4faffd047e07c38848ce017e8725090413cd80cbc23d86e55c587bf979e579c9", size = 15426, upload-time = "2025-09-27T18:37:27.316Z" }, + { url = "https://files.pythonhosted.org/packages/70/bc/6f1c2f612465f5fa89b95bead1f44dcb607670fd42891d8fdcd5d039f4f4/markupsafe-3.0.3-cp314-cp314t-win_arm64.whl", hash = "sha256:32001d6a8fc98c8cb5c947787c5d08b0a50663d139f1305bac5885d98d9b40fa", size = 14146, upload-time = "2025-09-27T18:37:28.327Z" }, +] + +[[package]] +name = "matplotlib" +version = "3.10.8" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "contourpy" }, + { name = "cycler" }, + { name = "fonttools" }, + { name = "kiwisolver" }, + { name = "numpy" }, + { name = "packaging" }, + { name = "pillow" }, + { name = "pyparsing" }, + { name = "python-dateutil" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/8a/76/d3c6e3a13fe484ebe7718d14e269c9569c4eb0020a968a327acb3b9a8fe6/matplotlib-3.10.8.tar.gz", hash = "sha256:2299372c19d56bcd35cf05a2738308758d32b9eaed2371898d8f5bd33f084aa3", size = 34806269, upload-time = "2025-12-10T22:56:51.155Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f8/86/de7e3a1cdcfc941483af70609edc06b83e7c8a0e0dc9ac325200a3f4d220/matplotlib-3.10.8-cp311-cp311-macosx_10_12_x86_64.whl", hash = "sha256:6be43b667360fef5c754dda5d25a32e6307a03c204f3c0fc5468b78fa87b4160", size = 8251215, upload-time = "2025-12-10T22:55:16.175Z" }, + { url = "https://files.pythonhosted.org/packages/fd/14/baad3222f424b19ce6ad243c71de1ad9ec6b2e4eb1e458a48fdc6d120401/matplotlib-3.10.8-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:a2b336e2d91a3d7006864e0990c83b216fcdca64b5a6484912902cef87313d78", size = 8139625, upload-time = "2025-12-10T22:55:17.712Z" }, + { url = "https://files.pythonhosted.org/packages/8f/a0/7024215e95d456de5883e6732e708d8187d9753a21d32f8ddb3befc0c445/matplotlib-3.10.8-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:efb30e3baaea72ce5928e32bab719ab4770099079d66726a62b11b1ef7273be4", size = 8712614, upload-time = "2025-12-10T22:55:20.8Z" }, + { url = "https://files.pythonhosted.org/packages/5a/f4/b8347351da9a5b3f41e26cf547252d861f685c6867d179a7c9d60ad50189/matplotlib-3.10.8-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d56a1efd5bfd61486c8bc968fa18734464556f0fb8e51690f4ac25d85cbbbbc2", size = 9540997, upload-time = "2025-12-10T22:55:23.258Z" }, + { url = "https://files.pythonhosted.org/packages/9e/c0/c7b914e297efe0bc36917bf216b2acb91044b91e930e878ae12981e461e5/matplotlib-3.10.8-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:238b7ce5717600615c895050239ec955d91f321c209dd110db988500558e70d6", size = 9596825, upload-time = "2025-12-10T22:55:25.217Z" }, + { url = "https://files.pythonhosted.org/packages/6f/d3/a4bbc01c237ab710a1f22b4da72f4ff6d77eb4c7735ea9811a94ae239067/matplotlib-3.10.8-cp311-cp311-win_amd64.whl", hash = "sha256:18821ace09c763ec93aef5eeff087ee493a24051936d7b9ebcad9662f66501f9", size = 8135090, upload-time = "2025-12-10T22:55:27.162Z" }, + { url = "https://files.pythonhosted.org/packages/89/dd/a0b6588f102beab33ca6f5218b31725216577b2a24172f327eaf6417d5c9/matplotlib-3.10.8-cp311-cp311-win_arm64.whl", hash = "sha256:bab485bcf8b1c7d2060b4fcb6fc368a9e6f4cd754c9c2fea281f4be21df394a2", size = 8012377, upload-time = "2025-12-10T22:55:29.185Z" }, + { url = "https://files.pythonhosted.org/packages/9e/67/f997cdcbb514012eb0d10cd2b4b332667997fb5ebe26b8d41d04962fa0e6/matplotlib-3.10.8-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:64fcc24778ca0404ce0cb7b6b77ae1f4c7231cdd60e6778f999ee05cbd581b9a", size = 8260453, upload-time = "2025-12-10T22:55:30.709Z" }, + { url = "https://files.pythonhosted.org/packages/7e/65/07d5f5c7f7c994f12c768708bd2e17a4f01a2b0f44a1c9eccad872433e2e/matplotlib-3.10.8-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:b9a5ca4ac220a0cdd1ba6bcba3608547117d30468fefce49bb26f55c1a3d5c58", size = 8148321, upload-time = "2025-12-10T22:55:33.265Z" }, + { url = "https://files.pythonhosted.org/packages/3e/f3/c5195b1ae57ef85339fd7285dfb603b22c8b4e79114bae5f4f0fcf688677/matplotlib-3.10.8-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:3ab4aabc72de4ff77b3ec33a6d78a68227bf1123465887f9905ba79184a1cc04", size = 8716944, upload-time = "2025-12-10T22:55:34.922Z" }, + { url = "https://files.pythonhosted.org/packages/00/f9/7638f5cc82ec8a7aa005de48622eecc3ed7c9854b96ba15bd76b7fd27574/matplotlib-3.10.8-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:24d50994d8c5816ddc35411e50a86ab05f575e2530c02752e02538122613371f", size = 9550099, upload-time = "2025-12-10T22:55:36.789Z" }, + { url = "https://files.pythonhosted.org/packages/57/61/78cd5920d35b29fd2a0fe894de8adf672ff52939d2e9b43cb83cd5ce1bc7/matplotlib-3.10.8-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:99eefd13c0dc3b3c1b4d561c1169e65fe47aab7b8158754d7c084088e2329466", size = 9613040, upload-time = "2025-12-10T22:55:38.715Z" }, + { url = "https://files.pythonhosted.org/packages/30/4e/c10f171b6e2f44d9e3a2b96efa38b1677439d79c99357600a62cc1e9594e/matplotlib-3.10.8-cp312-cp312-win_amd64.whl", hash = "sha256:dd80ecb295460a5d9d260df63c43f4afbdd832d725a531f008dad1664f458adf", size = 8142717, upload-time = "2025-12-10T22:55:41.103Z" }, + { url = "https://files.pythonhosted.org/packages/f1/76/934db220026b5fef85f45d51a738b91dea7d70207581063cd9bd8fafcf74/matplotlib-3.10.8-cp312-cp312-win_arm64.whl", hash = "sha256:3c624e43ed56313651bc18a47f838b60d7b8032ed348911c54906b130b20071b", size = 8012751, upload-time = "2025-12-10T22:55:42.684Z" }, + { url = "https://files.pythonhosted.org/packages/3d/b9/15fd5541ef4f5b9a17eefd379356cf12175fe577424e7b1d80676516031a/matplotlib-3.10.8-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:3f2e409836d7f5ac2f1c013110a4d50b9f7edc26328c108915f9075d7d7a91b6", size = 8261076, upload-time = "2025-12-10T22:55:44.648Z" }, + { url = "https://files.pythonhosted.org/packages/8d/a0/2ba3473c1b66b9c74dc7107c67e9008cb1782edbe896d4c899d39ae9cf78/matplotlib-3.10.8-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:56271f3dac49a88d7fca5060f004d9d22b865f743a12a23b1e937a0be4818ee1", size = 8148794, upload-time = "2025-12-10T22:55:46.252Z" }, + { url = "https://files.pythonhosted.org/packages/75/97/a471f1c3eb1fd6f6c24a31a5858f443891d5127e63a7788678d14e249aea/matplotlib-3.10.8-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:a0a7f52498f72f13d4a25ea70f35f4cb60642b466cbb0a9be951b5bc3f45a486", size = 8718474, upload-time = "2025-12-10T22:55:47.864Z" }, + { url = "https://files.pythonhosted.org/packages/01/be/cd478f4b66f48256f42927d0acbcd63a26a893136456cd079c0cc24fbabf/matplotlib-3.10.8-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:646d95230efb9ca614a7a594d4fcacde0ac61d25e37dd51710b36477594963ce", size = 9549637, upload-time = "2025-12-10T22:55:50.048Z" }, + { url = "https://files.pythonhosted.org/packages/5d/7c/8dc289776eae5109e268c4fb92baf870678dc048a25d4ac903683b86d5bf/matplotlib-3.10.8-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:f89c151aab2e2e23cb3fe0acad1e8b82841fd265379c4cecd0f3fcb34c15e0f6", size = 9613678, upload-time = "2025-12-10T22:55:52.21Z" }, + { url = "https://files.pythonhosted.org/packages/64/40/37612487cc8a437d4dd261b32ca21fe2d79510fe74af74e1f42becb1bdb8/matplotlib-3.10.8-cp313-cp313-win_amd64.whl", hash = "sha256:e8ea3e2d4066083e264e75c829078f9e149fa119d27e19acd503de65e0b13149", size = 8142686, upload-time = "2025-12-10T22:55:54.253Z" }, + { url = "https://files.pythonhosted.org/packages/66/52/8d8a8730e968185514680c2a6625943f70269509c3dcfc0dcf7d75928cb8/matplotlib-3.10.8-cp313-cp313-win_arm64.whl", hash = "sha256:c108a1d6fa78a50646029cb6d49808ff0fc1330fda87fa6f6250c6b5369b6645", size = 8012917, upload-time = "2025-12-10T22:55:56.268Z" }, + { url = "https://files.pythonhosted.org/packages/b5/27/51fe26e1062f298af5ef66343d8ef460e090a27fea73036c76c35821df04/matplotlib-3.10.8-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:ad3d9833a64cf48cc4300f2b406c3d0f4f4724a91c0bd5640678a6ba7c102077", size = 8305679, upload-time = "2025-12-10T22:55:57.856Z" }, + { url = "https://files.pythonhosted.org/packages/2c/1e/4de865bc591ac8e3062e835f42dd7fe7a93168d519557837f0e37513f629/matplotlib-3.10.8-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:eb3823f11823deade26ce3b9f40dcb4a213da7a670013929f31d5f5ed1055b22", size = 8198336, upload-time = "2025-12-10T22:55:59.371Z" }, + { url = "https://files.pythonhosted.org/packages/c6/cb/2f7b6e75fb4dce87ef91f60cac4f6e34f4c145ab036a22318ec837971300/matplotlib-3.10.8-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:d9050fee89a89ed57b4fb2c1bfac9a3d0c57a0d55aed95949eedbc42070fea39", size = 8731653, upload-time = "2025-12-10T22:56:01.032Z" }, + { url = "https://files.pythonhosted.org/packages/46/b3/bd9c57d6ba670a37ab31fb87ec3e8691b947134b201f881665b28cc039ff/matplotlib-3.10.8-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b44d07310e404ba95f8c25aa5536f154c0a8ec473303535949e52eb71d0a1565", size = 9561356, upload-time = "2025-12-10T22:56:02.95Z" }, + { url = "https://files.pythonhosted.org/packages/c0/3d/8b94a481456dfc9dfe6e39e93b5ab376e50998cddfd23f4ae3b431708f16/matplotlib-3.10.8-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:0a33deb84c15ede243aead39f77e990469fff93ad1521163305095b77b72ce4a", size = 9614000, upload-time = "2025-12-10T22:56:05.411Z" }, + { url = "https://files.pythonhosted.org/packages/bd/cd/bc06149fe5585ba800b189a6a654a75f1f127e8aab02fd2be10df7fa500c/matplotlib-3.10.8-cp313-cp313t-win_amd64.whl", hash = "sha256:3a48a78d2786784cc2413e57397981fb45c79e968d99656706018d6e62e57958", size = 8220043, upload-time = "2025-12-10T22:56:07.551Z" }, + { url = "https://files.pythonhosted.org/packages/e3/de/b22cf255abec916562cc04eef457c13e58a1990048de0c0c3604d082355e/matplotlib-3.10.8-cp313-cp313t-win_arm64.whl", hash = "sha256:15d30132718972c2c074cd14638c7f4592bd98719e2308bccea40e0538bc0cb5", size = 8062075, upload-time = "2025-12-10T22:56:09.178Z" }, + { url = "https://files.pythonhosted.org/packages/3c/43/9c0ff7a2f11615e516c3b058e1e6e8f9614ddeca53faca06da267c48345d/matplotlib-3.10.8-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:b53285e65d4fa4c86399979e956235deb900be5baa7fc1218ea67fbfaeaadd6f", size = 8262481, upload-time = "2025-12-10T22:56:10.885Z" }, + { url = "https://files.pythonhosted.org/packages/6f/ca/e8ae28649fcdf039fda5ef554b40a95f50592a3c47e6f7270c9561c12b07/matplotlib-3.10.8-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:32f8dce744be5569bebe789e46727946041199030db8aeb2954d26013a0eb26b", size = 8151473, upload-time = "2025-12-10T22:56:12.377Z" }, + { url = "https://files.pythonhosted.org/packages/f1/6f/009d129ae70b75e88cbe7e503a12a4c0670e08ed748a902c2568909e9eb5/matplotlib-3.10.8-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4cf267add95b1c88300d96ca837833d4112756045364f5c734a2276038dae27d", size = 9553896, upload-time = "2025-12-10T22:56:14.432Z" }, + { url = "https://files.pythonhosted.org/packages/f5/26/4221a741eb97967bc1fd5e4c52b9aa5a91b2f4ec05b59f6def4d820f9df9/matplotlib-3.10.8-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:2cf5bd12cecf46908f286d7838b2abc6c91cda506c0445b8223a7c19a00df008", size = 9824193, upload-time = "2025-12-10T22:56:16.29Z" }, + { url = "https://files.pythonhosted.org/packages/1f/f3/3abf75f38605772cf48a9daf5821cd4f563472f38b4b828c6fba6fa6d06e/matplotlib-3.10.8-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:41703cc95688f2516b480f7f339d8851a6035f18e100ee6a32bc0b8536a12a9c", size = 9615444, upload-time = "2025-12-10T22:56:18.155Z" }, + { url = "https://files.pythonhosted.org/packages/93/a5/de89ac80f10b8dc615807ee1133cd99ac74082581196d4d9590bea10690d/matplotlib-3.10.8-cp314-cp314-win_amd64.whl", hash = "sha256:83d282364ea9f3e52363da262ce32a09dfe241e4080dcedda3c0db059d3c1f11", size = 8272719, upload-time = "2025-12-10T22:56:20.366Z" }, + { url = "https://files.pythonhosted.org/packages/69/ce/b006495c19ccc0a137b48083168a37bd056392dee02f87dba0472f2797fe/matplotlib-3.10.8-cp314-cp314-win_arm64.whl", hash = "sha256:2c1998e92cd5999e295a731bcb2911c75f597d937341f3030cc24ef2733d78a8", size = 8144205, upload-time = "2025-12-10T22:56:22.239Z" }, + { url = "https://files.pythonhosted.org/packages/68/d9/b31116a3a855bd313c6fcdb7226926d59b041f26061c6c5b1be66a08c826/matplotlib-3.10.8-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:b5a2b97dbdc7d4f353ebf343744f1d1f1cca8aa8bfddb4262fcf4306c3761d50", size = 8305785, upload-time = "2025-12-10T22:56:24.218Z" }, + { url = "https://files.pythonhosted.org/packages/1e/90/6effe8103f0272685767ba5f094f453784057072f49b393e3ea178fe70a5/matplotlib-3.10.8-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:3f5c3e4da343bba819f0234186b9004faba952cc420fbc522dc4e103c1985908", size = 8198361, upload-time = "2025-12-10T22:56:26.787Z" }, + { url = "https://files.pythonhosted.org/packages/d7/65/a73188711bea603615fc0baecca1061429ac16940e2385433cc778a9d8e7/matplotlib-3.10.8-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5f62550b9a30afde8c1c3ae450e5eb547d579dd69b25c2fc7a1c67f934c1717a", size = 9561357, upload-time = "2025-12-10T22:56:28.953Z" }, + { url = "https://files.pythonhosted.org/packages/f4/3d/b5c5d5d5be8ce63292567f0e2c43dde9953d3ed86ac2de0a72e93c8f07a1/matplotlib-3.10.8-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:495672de149445ec1b772ff2c9ede9b769e3cb4f0d0aa7fa730d7f59e2d4e1c1", size = 9823610, upload-time = "2025-12-10T22:56:31.455Z" }, + { url = "https://files.pythonhosted.org/packages/4d/4b/e7beb6bbd49f6bae727a12b270a2654d13c397576d25bd6786e47033300f/matplotlib-3.10.8-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:595ba4d8fe983b88f0eec8c26a241e16d6376fe1979086232f481f8f3f67494c", size = 9614011, upload-time = "2025-12-10T22:56:33.85Z" }, + { url = "https://files.pythonhosted.org/packages/7c/e6/76f2813d31f032e65f6f797e3f2f6e4aab95b65015924b1c51370395c28a/matplotlib-3.10.8-cp314-cp314t-win_amd64.whl", hash = "sha256:25d380fe8b1dc32cf8f0b1b448470a77afb195438bafdf1d858bfb876f3edf7b", size = 8362801, upload-time = "2025-12-10T22:56:36.107Z" }, + { url = "https://files.pythonhosted.org/packages/5d/49/d651878698a0b67f23aa28e17f45a6d6dd3d3f933fa29087fa4ce5947b5a/matplotlib-3.10.8-cp314-cp314t-win_arm64.whl", hash = "sha256:113bb52413ea508ce954a02c10ffd0d565f9c3bc7f2eddc27dfe1731e71c7b5f", size = 8192560, upload-time = "2025-12-10T22:56:38.008Z" }, + { url = "https://files.pythonhosted.org/packages/04/30/3afaa31c757f34b7725ab9d2ba8b48b5e89c2019c003e7d0ead143aabc5a/matplotlib-3.10.8-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:6da7c2ce169267d0d066adcf63758f0604aa6c3eebf67458930f9d9b79ad1db1", size = 8249198, upload-time = "2025-12-10T22:56:45.584Z" }, + { url = "https://files.pythonhosted.org/packages/48/2f/6334aec331f57485a642a7c8be03cb286f29111ae71c46c38b363230063c/matplotlib-3.10.8-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:9153c3292705be9f9c64498a8872118540c3f4123d1a1c840172edf262c8be4a", size = 8136817, upload-time = "2025-12-10T22:56:47.339Z" }, + { url = "https://files.pythonhosted.org/packages/73/e4/6d6f14b2a759c622f191b2d67e9075a3f56aaccb3be4bb9bb6890030d0a0/matplotlib-3.10.8-pp311-pypy311_pp73-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:1ae029229a57cd1e8fe542485f27e7ca7b23aa9e8944ddb4985d0bc444f1eca2", size = 8713867, upload-time = "2025-12-10T22:56:48.954Z" }, +] + +[[package]] +name = "matplotlib-inline" +version = "0.2.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "traitlets" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/c7/74/97e72a36efd4ae2bccb3463284300f8953f199b5ffbc04cbbb0ec78f74b1/matplotlib_inline-0.2.1.tar.gz", hash = "sha256:e1ee949c340d771fc39e241ea75683deb94762c8fa5f2927ec57c83c4dffa9fe", size = 8110, upload-time = "2025-10-23T09:00:22.126Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/af/33/ee4519fa02ed11a94aef9559552f3b17bb863f2ecfe1a35dc7f548cde231/matplotlib_inline-0.2.1-py3-none-any.whl", hash = "sha256:d56ce5156ba6085e00a9d54fead6ed29a9c47e215cd1bba2e976ef39f5710a76", size = 9516, upload-time = "2025-10-23T09:00:20.675Z" }, +] + +[[package]] +name = "mdurl" +version = "0.1.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/d6/54/cfe61301667036ec958cb99bd3efefba235e65cdeb9c84d24a8293ba1d90/mdurl-0.1.2.tar.gz", hash = "sha256:bb413d29f5eea38f31dd4754dd7377d4465116fb207585f97bf925588687c1ba", size = 8729, upload-time = "2022-08-14T12:40:10.846Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b3/38/89ba8ad64ae25be8de66a6d463314cf1eb366222074cfda9ee839c56a4b4/mdurl-0.1.2-py3-none-any.whl", hash = "sha256:84008a41e51615a49fc9966191ff91509e3c40b939176e643fd50a5c2196b8f8", size = 9979, upload-time = "2022-08-14T12:40:09.779Z" }, +] + +[[package]] +name = "mistune" +version = "3.2.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/9d/55/d01f0c4b45ade6536c51170b9043db8b2ec6ddf4a35c7ea3f5f559ac935b/mistune-3.2.0.tar.gz", hash = "sha256:708487c8a8cdd99c9d90eb3ed4c3ed961246ff78ac82f03418f5183ab70e398a", size = 95467, upload-time = "2025-12-23T11:36:34.994Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/9b/f7/4a5e785ec9fbd65146a27b6b70b6cdc161a66f2024e4b04ac06a67f5578b/mistune-3.2.0-py3-none-any.whl", hash = "sha256:febdc629a3c78616b94393c6580551e0e34cc289987ec6c35ed3f4be42d0eee1", size = 53598, upload-time = "2025-12-23T11:36:33.211Z" }, +] + +[[package]] +name = "ml-dtypes" +version = "0.5.4" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/0e/4a/c27b42ed9b1c7d13d9ba8b6905dece787d6259152f2309338aed29b2447b/ml_dtypes-0.5.4.tar.gz", hash = "sha256:8ab06a50fb9bf9666dd0fe5dfb4676fa2b0ac0f31ecff72a6c3af8e22c063453", size = 692314, upload-time = "2025-11-17T22:32:31.031Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c6/5e/712092cfe7e5eb667b8ad9ca7c54442f21ed7ca8979745f1000e24cf8737/ml_dtypes-0.5.4-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:6c7ecb74c4bd71db68a6bea1edf8da8c34f3d9fe218f038814fd1d310ac76c90", size = 679734, upload-time = "2025-11-17T22:31:39.223Z" }, + { url = "https://files.pythonhosted.org/packages/4f/cf/912146dfd4b5c0eea956836c01dcd2fce6c9c844b2691f5152aca196ce4f/ml_dtypes-0.5.4-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:bc11d7e8c44a65115d05e2ab9989d1e045125d7be8e05a071a48bc76eb6d6040", size = 5056165, upload-time = "2025-11-17T22:31:41.071Z" }, + { url = "https://files.pythonhosted.org/packages/a9/80/19189ea605017473660e43762dc853d2797984b3c7bf30ce656099add30c/ml_dtypes-0.5.4-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:19b9a53598f21e453ea2fbda8aa783c20faff8e1eeb0d7ab899309a0053f1483", size = 5034975, upload-time = "2025-11-17T22:31:42.758Z" }, + { url = "https://files.pythonhosted.org/packages/b4/24/70bd59276883fdd91600ca20040b41efd4902a923283c4d6edcb1de128d2/ml_dtypes-0.5.4-cp311-cp311-win_amd64.whl", hash = "sha256:7c23c54a00ae43edf48d44066a7ec31e05fdc2eee0be2b8b50dd1903a1db94bb", size = 210742, upload-time = "2025-11-17T22:31:44.068Z" }, + { url = "https://files.pythonhosted.org/packages/a0/c9/64230ef14e40aa3f1cb254ef623bf812735e6bec7772848d19131111ac0d/ml_dtypes-0.5.4-cp311-cp311-win_arm64.whl", hash = "sha256:557a31a390b7e9439056644cb80ed0735a6e3e3bb09d67fd5687e4b04238d1de", size = 160709, upload-time = "2025-11-17T22:31:46.557Z" }, + { url = "https://files.pythonhosted.org/packages/a8/b8/3c70881695e056f8a32f8b941126cf78775d9a4d7feba8abcb52cb7b04f2/ml_dtypes-0.5.4-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:a174837a64f5b16cab6f368171a1a03a27936b31699d167684073ff1c4237dac", size = 676927, upload-time = "2025-11-17T22:31:48.182Z" }, + { url = "https://files.pythonhosted.org/packages/54/0f/428ef6881782e5ebb7eca459689448c0394fa0a80bea3aa9262cba5445ea/ml_dtypes-0.5.4-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a7f7c643e8b1320fd958bf098aa7ecf70623a42ec5154e3be3be673f4c34d900", size = 5028464, upload-time = "2025-11-17T22:31:50.135Z" }, + { url = "https://files.pythonhosted.org/packages/3a/cb/28ce52eb94390dda42599c98ea0204d74799e4d8047a0eb559b6fd648056/ml_dtypes-0.5.4-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9ad459e99793fa6e13bd5b7e6792c8f9190b4e5a1b45c63aba14a4d0a7f1d5ff", size = 5009002, upload-time = "2025-11-17T22:31:52.001Z" }, + { url = "https://files.pythonhosted.org/packages/f5/f0/0cfadd537c5470378b1b32bd859cf2824972174b51b873c9d95cfd7475a5/ml_dtypes-0.5.4-cp312-cp312-win_amd64.whl", hash = "sha256:c1a953995cccb9e25a4ae19e34316671e4e2edaebe4cf538229b1fc7109087b7", size = 212222, upload-time = "2025-11-17T22:31:53.742Z" }, + { url = "https://files.pythonhosted.org/packages/16/2e/9acc86985bfad8f2c2d30291b27cd2bb4c74cea08695bd540906ed744249/ml_dtypes-0.5.4-cp312-cp312-win_arm64.whl", hash = "sha256:9bad06436568442575beb2d03389aa7456c690a5b05892c471215bfd8cf39460", size = 160793, upload-time = "2025-11-17T22:31:55.358Z" }, + { url = "https://files.pythonhosted.org/packages/d9/a1/4008f14bbc616cfb1ac5b39ea485f9c63031c4634ab3f4cf72e7541f816a/ml_dtypes-0.5.4-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:8c760d85a2f82e2bed75867079188c9d18dae2ee77c25a54d60e9cc79be1bc48", size = 676888, upload-time = "2025-11-17T22:31:56.907Z" }, + { url = "https://files.pythonhosted.org/packages/d3/b7/dff378afc2b0d5a7d6cd9d3209b60474d9819d1189d347521e1688a60a53/ml_dtypes-0.5.4-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ce756d3a10d0c4067172804c9cc276ba9cc0ff47af9078ad439b075d1abdc29b", size = 5036993, upload-time = "2025-11-17T22:31:58.497Z" }, + { url = "https://files.pythonhosted.org/packages/eb/33/40cd74219417e78b97c47802037cf2d87b91973e18bb968a7da48a96ea44/ml_dtypes-0.5.4-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:533ce891ba774eabf607172254f2e7260ba5f57bdd64030c9a4fcfbd99815d0d", size = 5010956, upload-time = "2025-11-17T22:31:59.931Z" }, + { url = "https://files.pythonhosted.org/packages/e1/8b/200088c6859d8221454825959df35b5244fa9bdf263fd0249ac5fb75e281/ml_dtypes-0.5.4-cp313-cp313-win_amd64.whl", hash = "sha256:f21c9219ef48ca5ee78402d5cc831bd58ea27ce89beda894428bc67a52da5328", size = 212224, upload-time = "2025-11-17T22:32:01.349Z" }, + { url = "https://files.pythonhosted.org/packages/8f/75/dfc3775cb36367816e678f69a7843f6f03bd4e2bcd79941e01ea960a068e/ml_dtypes-0.5.4-cp313-cp313-win_arm64.whl", hash = "sha256:35f29491a3e478407f7047b8a4834e4640a77d2737e0b294d049746507af5175", size = 160798, upload-time = "2025-11-17T22:32:02.864Z" }, + { url = "https://files.pythonhosted.org/packages/4f/74/e9ddb35fd1dd43b1106c20ced3f53c2e8e7fc7598c15638e9f80677f81d4/ml_dtypes-0.5.4-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:304ad47faa395415b9ccbcc06a0350800bc50eda70f0e45326796e27c62f18b6", size = 702083, upload-time = "2025-11-17T22:32:04.08Z" }, + { url = "https://files.pythonhosted.org/packages/74/f5/667060b0aed1aa63166b22897fdf16dca9eb704e6b4bbf86848d5a181aa7/ml_dtypes-0.5.4-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6a0df4223b514d799b8a1629c65ddc351b3efa833ccf7f8ea0cf654a61d1e35d", size = 5354111, upload-time = "2025-11-17T22:32:05.546Z" }, + { url = "https://files.pythonhosted.org/packages/40/49/0f8c498a28c0efa5f5c95a9e374c83ec1385ca41d0e85e7cf40e5d519a21/ml_dtypes-0.5.4-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:531eff30e4d368cb6255bc2328d070e35836aa4f282a0fb5f3a0cd7260257298", size = 5366453, upload-time = "2025-11-17T22:32:07.115Z" }, + { url = "https://files.pythonhosted.org/packages/8c/27/12607423d0a9c6bbbcc780ad19f1f6baa2b68b18ce4bddcdc122c4c68dc9/ml_dtypes-0.5.4-cp313-cp313t-win_amd64.whl", hash = "sha256:cb73dccfc991691c444acc8c0012bee8f2470da826a92e3a20bb333b1a7894e6", size = 225612, upload-time = "2025-11-17T22:32:08.615Z" }, + { url = "https://files.pythonhosted.org/packages/e5/80/5a5929e92c72936d5b19872c5fb8fc09327c1da67b3b68c6a13139e77e20/ml_dtypes-0.5.4-cp313-cp313t-win_arm64.whl", hash = "sha256:3bbbe120b915090d9dd1375e4684dd17a20a2491ef25d640a908281da85e73f1", size = 164145, upload-time = "2025-11-17T22:32:09.782Z" }, + { url = "https://files.pythonhosted.org/packages/72/4e/1339dc6e2557a344f5ba5590872e80346f76f6cb2ac3dd16e4666e88818c/ml_dtypes-0.5.4-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:2b857d3af6ac0d39db1de7c706e69c7f9791627209c3d6dedbfca8c7e5faec22", size = 673781, upload-time = "2025-11-17T22:32:11.364Z" }, + { url = "https://files.pythonhosted.org/packages/04/f9/067b84365c7e83bda15bba2b06c6ca250ce27b20630b1128c435fb7a09aa/ml_dtypes-0.5.4-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:805cef3a38f4eafae3a5bf9ebdcdb741d0bcfd9e1bd90eb54abd24f928cd2465", size = 5036145, upload-time = "2025-11-17T22:32:12.783Z" }, + { url = "https://files.pythonhosted.org/packages/c6/bb/82c7dcf38070b46172a517e2334e665c5bf374a262f99a283ea454bece7c/ml_dtypes-0.5.4-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:14a4fd3228af936461db66faccef6e4f41c1d82fcc30e9f8d58a08916b1d811f", size = 5010230, upload-time = "2025-11-17T22:32:14.38Z" }, + { url = "https://files.pythonhosted.org/packages/e9/93/2bfed22d2498c468f6bcd0d9f56b033eaa19f33320389314c19ef6766413/ml_dtypes-0.5.4-cp314-cp314-win_amd64.whl", hash = "sha256:8c6a2dcebd6f3903e05d51960a8058d6e131fe69f952a5397e5dbabc841b6d56", size = 221032, upload-time = "2025-11-17T22:32:15.763Z" }, + { url = "https://files.pythonhosted.org/packages/76/a3/9c912fe6ea747bb10fe2f8f54d027eb265db05dfb0c6335e3e063e74e6e8/ml_dtypes-0.5.4-cp314-cp314-win_arm64.whl", hash = "sha256:5a0f68ca8fd8d16583dfa7793973feb86f2fbb56ce3966daf9c9f748f52a2049", size = 163353, upload-time = "2025-11-17T22:32:16.932Z" }, + { url = "https://files.pythonhosted.org/packages/cd/02/48aa7d84cc30ab4ee37624a2fd98c56c02326785750cd212bc0826c2f15b/ml_dtypes-0.5.4-cp314-cp314t-macosx_10_13_universal2.whl", hash = "sha256:bfc534409c5d4b0bf945af29e5d0ab075eae9eecbb549ff8a29280db822f34f9", size = 702085, upload-time = "2025-11-17T22:32:18.175Z" }, + { url = "https://files.pythonhosted.org/packages/5a/e7/85cb99fe80a7a5513253ec7faa88a65306be071163485e9a626fce1b6e84/ml_dtypes-0.5.4-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:2314892cdc3fcf05e373d76d72aaa15fda9fb98625effa73c1d646f331fcecb7", size = 5355358, upload-time = "2025-11-17T22:32:19.7Z" }, + { url = "https://files.pythonhosted.org/packages/79/2b/a826ba18d2179a56e144aef69e57fb2ab7c464ef0b2111940ee8a3a223a2/ml_dtypes-0.5.4-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:0d2ffd05a2575b1519dc928c0b93c06339eb67173ff53acb00724502cda231cf", size = 5366332, upload-time = "2025-11-17T22:32:21.193Z" }, + { url = "https://files.pythonhosted.org/packages/84/44/f4d18446eacb20ea11e82f133ea8f86e2bf2891785b67d9da8d0ab0ef525/ml_dtypes-0.5.4-cp314-cp314t-win_amd64.whl", hash = "sha256:4381fe2f2452a2d7589689693d3162e876b3ddb0a832cde7a414f8e1adf7eab1", size = 236612, upload-time = "2025-11-17T22:32:22.579Z" }, + { url = "https://files.pythonhosted.org/packages/ad/3f/3d42e9a78fe5edf792a83c074b13b9b770092a4fbf3462872f4303135f09/ml_dtypes-0.5.4-cp314-cp314t-win_arm64.whl", hash = "sha256:11942cbf2cf92157db91e5022633c0d9474d4dfd813a909383bd23ce828a4b7d", size = 168825, upload-time = "2025-11-17T22:32:23.766Z" }, +] + +[[package]] +name = "mpmath" +version = "1.3.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/e0/47/dd32fa426cc72114383ac549964eecb20ecfd886d1e5ccf5340b55b02f57/mpmath-1.3.0.tar.gz", hash = "sha256:7a28eb2a9774d00c7bc92411c19a89209d5da7c4c9a9e227be8330a23a25b91f", size = 508106, upload-time = "2023-03-07T16:47:11.061Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/43/e3/7d92a15f894aa0c9c4b49b8ee9ac9850d6e63b03c9c32c0367a13ae62209/mpmath-1.3.0-py3-none-any.whl", hash = "sha256:a0b2b9fe80bbcd81a6647ff13108738cfb482d481d826cc0e02f5b35e5c88d2c", size = 536198, upload-time = "2023-03-07T16:47:09.197Z" }, +] + +[[package]] +name = "multidict" +version = "6.7.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/1a/c2/c2d94cbe6ac1753f3fc980da97b3d930efe1da3af3c9f5125354436c073d/multidict-6.7.1.tar.gz", hash = "sha256:ec6652a1bee61c53a3e5776b6049172c53b6aaba34f18c9ad04f82712bac623d", size = 102010, upload-time = "2026-01-26T02:46:45.979Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ce/f1/a90635c4f88fb913fbf4ce660b83b7445b7a02615bda034b2f8eb38fd597/multidict-6.7.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:7ff981b266af91d7b4b3793ca3382e53229088d193a85dfad6f5f4c27fc73e5d", size = 76626, upload-time = "2026-01-26T02:43:26.485Z" }, + { url = "https://files.pythonhosted.org/packages/a6/9b/267e64eaf6fc637a15b35f5de31a566634a2740f97d8d094a69d34f524a4/multidict-6.7.1-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:844c5bca0b5444adb44a623fb0a1310c2f4cd41f402126bb269cd44c9b3f3e1e", size = 44706, upload-time = "2026-01-26T02:43:27.607Z" }, + { url = "https://files.pythonhosted.org/packages/dd/a4/d45caf2b97b035c57267791ecfaafbd59c68212004b3842830954bb4b02e/multidict-6.7.1-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:f2a0a924d4c2e9afcd7ec64f9de35fcd96915149b2216e1cb2c10a56df483855", size = 44356, upload-time = "2026-01-26T02:43:28.661Z" }, + { url = "https://files.pythonhosted.org/packages/fd/d2/0a36c8473f0cbaeadd5db6c8b72d15bbceeec275807772bfcd059bef487d/multidict-6.7.1-cp311-cp311-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:8be1802715a8e892c784c0197c2ace276ea52702a0ede98b6310c8f255a5afb3", size = 244355, upload-time = "2026-01-26T02:43:31.165Z" }, + { url = "https://files.pythonhosted.org/packages/5d/16/8c65be997fd7dd311b7d39c7b6e71a0cb449bad093761481eccbbe4b42a2/multidict-6.7.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:2e2d2ed645ea29f31c4c7ea1552fcfd7cb7ba656e1eafd4134a6620c9f5fdd9e", size = 246433, upload-time = "2026-01-26T02:43:32.581Z" }, + { url = "https://files.pythonhosted.org/packages/01/fb/4dbd7e848d2799c6a026ec88ad39cf2b8416aa167fcc903baa55ecaa045c/multidict-6.7.1-cp311-cp311-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:95922cee9a778659e91db6497596435777bd25ed116701a4c034f8e46544955a", size = 225376, upload-time = "2026-01-26T02:43:34.417Z" }, + { url = "https://files.pythonhosted.org/packages/b6/8a/4a3a6341eac3830f6053062f8fbc9a9e54407c80755b3f05bc427295c2d0/multidict-6.7.1-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:6b83cabdc375ffaaa15edd97eb7c0c672ad788e2687004990074d7d6c9b140c8", size = 257365, upload-time = "2026-01-26T02:43:35.741Z" }, + { url = "https://files.pythonhosted.org/packages/f7/a2/dd575a69c1aa206e12d27d0770cdf9b92434b48a9ef0cd0d1afdecaa93c4/multidict-6.7.1-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:38fb49540705369bab8484db0689d86c0a33a0a9f2c1b197f506b71b4b6c19b0", size = 254747, upload-time = "2026-01-26T02:43:36.976Z" }, + { url = "https://files.pythonhosted.org/packages/5a/56/21b27c560c13822ed93133f08aa6372c53a8e067f11fbed37b4adcdac922/multidict-6.7.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:439cbebd499f92e9aa6793016a8acaa161dfa749ae86d20960189f5398a19144", size = 246293, upload-time = "2026-01-26T02:43:38.258Z" }, + { url = "https://files.pythonhosted.org/packages/5a/a4/23466059dc3854763423d0ad6c0f3683a379d97673b1b89ec33826e46728/multidict-6.7.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:6d3bc717b6fe763b8be3f2bee2701d3c8eb1b2a8ae9f60910f1b2860c82b6c49", size = 242962, upload-time = "2026-01-26T02:43:40.034Z" }, + { url = "https://files.pythonhosted.org/packages/1f/67/51dd754a3524d685958001e8fa20a0f5f90a6a856e0a9dcabff69be3dbb7/multidict-6.7.1-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:619e5a1ac57986dbfec9f0b301d865dddf763696435e2962f6d9cf2fdff2bb71", size = 237360, upload-time = "2026-01-26T02:43:41.752Z" }, + { url = "https://files.pythonhosted.org/packages/64/3f/036dfc8c174934d4b55d86ff4f978e558b0e585cef70cfc1ad01adc6bf18/multidict-6.7.1-cp311-cp311-musllinux_1_2_i686.whl", hash = "sha256:0b38ebffd9be37c1170d33bc0f36f4f262e0a09bc1aac1c34c7aa51a7293f0b3", size = 245940, upload-time = "2026-01-26T02:43:43.042Z" }, + { url = "https://files.pythonhosted.org/packages/3d/20/6214d3c105928ebc353a1c644a6ef1408bc5794fcb4f170bb524a3c16311/multidict-6.7.1-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:10ae39c9cfe6adedcdb764f5e8411d4a92b055e35573a2eaa88d3323289ef93c", size = 253502, upload-time = "2026-01-26T02:43:44.371Z" }, + { url = "https://files.pythonhosted.org/packages/b1/e2/c653bc4ae1be70a0f836b82172d643fcf1dade042ba2676ab08ec08bff0f/multidict-6.7.1-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:25167cc263257660290fba06b9318d2026e3c910be240a146e1f66dd114af2b0", size = 247065, upload-time = "2026-01-26T02:43:45.745Z" }, + { url = "https://files.pythonhosted.org/packages/c8/11/a854b4154cd3bd8b1fd375e8a8ca9d73be37610c361543d56f764109509b/multidict-6.7.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:128441d052254f42989ef98b7b6a6ecb1e6f708aa962c7984235316db59f50fa", size = 241870, upload-time = "2026-01-26T02:43:47.054Z" }, + { url = "https://files.pythonhosted.org/packages/13/bf/9676c0392309b5fdae322333d22a829715b570edb9baa8016a517b55b558/multidict-6.7.1-cp311-cp311-win32.whl", hash = "sha256:d62b7f64ffde3b99d06b707a280db04fb3855b55f5a06df387236051d0668f4a", size = 41302, upload-time = "2026-01-26T02:43:48.753Z" }, + { url = "https://files.pythonhosted.org/packages/c9/68/f16a3a8ba6f7b6dc92a1f19669c0810bd2c43fc5a02da13b1cbf8e253845/multidict-6.7.1-cp311-cp311-win_amd64.whl", hash = "sha256:bdbf9f3b332abd0cdb306e7c2113818ab1e922dc84b8f8fd06ec89ed2a19ab8b", size = 45981, upload-time = "2026-01-26T02:43:49.921Z" }, + { url = "https://files.pythonhosted.org/packages/ac/ad/9dd5305253fa00cd3c7555dbef69d5bf4133debc53b87ab8d6a44d411665/multidict-6.7.1-cp311-cp311-win_arm64.whl", hash = "sha256:b8c990b037d2fff2f4e33d3f21b9b531c5745b33a49a7d6dbe7a177266af44f6", size = 43159, upload-time = "2026-01-26T02:43:51.635Z" }, + { url = "https://files.pythonhosted.org/packages/8d/9c/f20e0e2cf80e4b2e4b1c365bf5fe104ee633c751a724246262db8f1a0b13/multidict-6.7.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:a90f75c956e32891a4eda3639ce6dd86e87105271f43d43442a3aedf3cddf172", size = 76893, upload-time = "2026-01-26T02:43:52.754Z" }, + { url = "https://files.pythonhosted.org/packages/fe/cf/18ef143a81610136d3da8193da9d80bfe1cb548a1e2d1c775f26b23d024a/multidict-6.7.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:3fccb473e87eaa1382689053e4a4618e7ba7b9b9b8d6adf2027ee474597128cd", size = 45456, upload-time = "2026-01-26T02:43:53.893Z" }, + { url = "https://files.pythonhosted.org/packages/a9/65/1caac9d4cd32e8433908683446eebc953e82d22b03d10d41a5f0fefe991b/multidict-6.7.1-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:b0fa96985700739c4c7853a43c0b3e169360d6855780021bfc6d0f1ce7c123e7", size = 43872, upload-time = "2026-01-26T02:43:55.041Z" }, + { url = "https://files.pythonhosted.org/packages/cf/3b/d6bd75dc4f3ff7c73766e04e705b00ed6dbbaccf670d9e05a12b006f5a21/multidict-6.7.1-cp312-cp312-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:cb2a55f408c3043e42b40cc8eecd575afa27b7e0b956dfb190de0f8499a57a53", size = 251018, upload-time = "2026-01-26T02:43:56.198Z" }, + { url = "https://files.pythonhosted.org/packages/fd/80/c959c5933adedb9ac15152e4067c702a808ea183a8b64cf8f31af8ad3155/multidict-6.7.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:eb0ce7b2a32d09892b3dd6cc44877a0d02a33241fafca5f25c8b6b62374f8b75", size = 258883, upload-time = "2026-01-26T02:43:57.499Z" }, + { url = "https://files.pythonhosted.org/packages/86/85/7ed40adafea3d4f1c8b916e3b5cc3a8e07dfcdcb9cd72800f4ed3ca1b387/multidict-6.7.1-cp312-cp312-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:c3a32d23520ee37bf327d1e1a656fec76a2edd5c038bf43eddfa0572ec49c60b", size = 242413, upload-time = "2026-01-26T02:43:58.755Z" }, + { url = "https://files.pythonhosted.org/packages/d2/57/b8565ff533e48595503c785f8361ff9a4fde4d67de25c207cd0ba3befd03/multidict-6.7.1-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:9c90fed18bffc0189ba814749fdcc102b536e83a9f738a9003e569acd540a733", size = 268404, upload-time = "2026-01-26T02:44:00.216Z" }, + { url = "https://files.pythonhosted.org/packages/e0/50/9810c5c29350f7258180dfdcb2e52783a0632862eb334c4896ac717cebcb/multidict-6.7.1-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:da62917e6076f512daccfbbde27f46fed1c98fee202f0559adec8ee0de67f71a", size = 269456, upload-time = "2026-01-26T02:44:02.202Z" }, + { url = "https://files.pythonhosted.org/packages/f3/8d/5e5be3ced1d12966fefb5c4ea3b2a5b480afcea36406559442c6e31d4a48/multidict-6.7.1-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:bfde23ef6ed9db7eaee6c37dcec08524cb43903c60b285b172b6c094711b3961", size = 256322, upload-time = "2026-01-26T02:44:03.56Z" }, + { url = "https://files.pythonhosted.org/packages/31/6e/d8a26d81ac166a5592782d208dd90dfdc0a7a218adaa52b45a672b46c122/multidict-6.7.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:3758692429e4e32f1ba0df23219cd0b4fc0a52f476726fff9337d1a57676a582", size = 253955, upload-time = "2026-01-26T02:44:04.845Z" }, + { url = "https://files.pythonhosted.org/packages/59/4c/7c672c8aad41534ba619bcd4ade7a0dc87ed6b8b5c06149b85d3dd03f0cd/multidict-6.7.1-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:398c1478926eca669f2fd6a5856b6de9c0acf23a2cb59a14c0ba5844fa38077e", size = 251254, upload-time = "2026-01-26T02:44:06.133Z" }, + { url = "https://files.pythonhosted.org/packages/7b/bd/84c24de512cbafbdbc39439f74e967f19570ce7924e3007174a29c348916/multidict-6.7.1-cp312-cp312-musllinux_1_2_i686.whl", hash = "sha256:c102791b1c4f3ab36ce4101154549105a53dc828f016356b3e3bcae2e3a039d3", size = 252059, upload-time = "2026-01-26T02:44:07.518Z" }, + { url = "https://files.pythonhosted.org/packages/fa/ba/f5449385510825b73d01c2d4087bf6d2fccc20a2d42ac34df93191d3dd03/multidict-6.7.1-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:a088b62bd733e2ad12c50dad01b7d0166c30287c166e137433d3b410add807a6", size = 263588, upload-time = "2026-01-26T02:44:09.382Z" }, + { url = "https://files.pythonhosted.org/packages/d7/11/afc7c677f68f75c84a69fe37184f0f82fce13ce4b92f49f3db280b7e92b3/multidict-6.7.1-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:3d51ff4785d58d3f6c91bdbffcb5e1f7ddfda557727043aa20d20ec4f65e324a", size = 259642, upload-time = "2026-01-26T02:44:10.73Z" }, + { url = "https://files.pythonhosted.org/packages/2b/17/ebb9644da78c4ab36403739e0e6e0e30ebb135b9caf3440825001a0bddcb/multidict-6.7.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:fc5907494fccf3e7d3f94f95c91d6336b092b5fc83811720fae5e2765890dfba", size = 251377, upload-time = "2026-01-26T02:44:12.042Z" }, + { url = "https://files.pythonhosted.org/packages/ca/a4/840f5b97339e27846c46307f2530a2805d9d537d8b8bd416af031cad7fa0/multidict-6.7.1-cp312-cp312-win32.whl", hash = "sha256:28ca5ce2fd9716631133d0e9a9b9a745ad7f60bac2bccafb56aa380fc0b6c511", size = 41887, upload-time = "2026-01-26T02:44:14.245Z" }, + { url = "https://files.pythonhosted.org/packages/80/31/0b2517913687895f5904325c2069d6a3b78f66cc641a86a2baf75a05dcbb/multidict-6.7.1-cp312-cp312-win_amd64.whl", hash = "sha256:fcee94dfbd638784645b066074b338bc9cc155d4b4bffa4adce1615c5a426c19", size = 46053, upload-time = "2026-01-26T02:44:15.371Z" }, + { url = "https://files.pythonhosted.org/packages/0c/5b/aba28e4ee4006ae4c7df8d327d31025d760ffa992ea23812a601d226e682/multidict-6.7.1-cp312-cp312-win_arm64.whl", hash = "sha256:ba0a9fb644d0c1a2194cf7ffb043bd852cea63a57f66fbd33959f7dae18517bf", size = 43307, upload-time = "2026-01-26T02:44:16.852Z" }, + { url = "https://files.pythonhosted.org/packages/f2/22/929c141d6c0dba87d3e1d38fbdf1ba8baba86b7776469f2bc2d3227a1e67/multidict-6.7.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:2b41f5fed0ed563624f1c17630cb9941cf2309d4df00e494b551b5f3e3d67a23", size = 76174, upload-time = "2026-01-26T02:44:18.509Z" }, + { url = "https://files.pythonhosted.org/packages/c7/75/bc704ae15fee974f8fccd871305e254754167dce5f9e42d88a2def741a1d/multidict-6.7.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:84e61e3af5463c19b67ced91f6c634effb89ef8bfc5ca0267f954451ed4bb6a2", size = 45116, upload-time = "2026-01-26T02:44:19.745Z" }, + { url = "https://files.pythonhosted.org/packages/79/76/55cd7186f498ed080a18440c9013011eb548f77ae1b297206d030eb1180a/multidict-6.7.1-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:935434b9853c7c112eee7ac891bc4cb86455aa631269ae35442cb316790c1445", size = 43524, upload-time = "2026-01-26T02:44:21.571Z" }, + { url = "https://files.pythonhosted.org/packages/e9/3c/414842ef8d5a1628d68edee29ba0e5bcf235dbfb3ccd3ea303a7fe8c72ff/multidict-6.7.1-cp313-cp313-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:432feb25a1cb67fe82a9680b4d65fb542e4635cb3166cd9c01560651ad60f177", size = 249368, upload-time = "2026-01-26T02:44:22.803Z" }, + { url = "https://files.pythonhosted.org/packages/f6/32/befed7f74c458b4a525e60519fe8d87eef72bb1e99924fa2b0f9d97a221e/multidict-6.7.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e82d14e3c948952a1a85503817e038cba5905a3352de76b9a465075d072fba23", size = 256952, upload-time = "2026-01-26T02:44:24.306Z" }, + { url = "https://files.pythonhosted.org/packages/03/d6/c878a44ba877f366630c860fdf74bfb203c33778f12b6ac274936853c451/multidict-6.7.1-cp313-cp313-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:4cfb48c6ea66c83bcaaf7e4dfa7ec1b6bbcf751b7db85a328902796dfde4c060", size = 240317, upload-time = "2026-01-26T02:44:25.772Z" }, + { url = "https://files.pythonhosted.org/packages/68/49/57421b4d7ad2e9e60e25922b08ceb37e077b90444bde6ead629095327a6f/multidict-6.7.1-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:1d540e51b7e8e170174555edecddbd5538105443754539193e3e1061864d444d", size = 267132, upload-time = "2026-01-26T02:44:27.648Z" }, + { url = "https://files.pythonhosted.org/packages/b7/fe/ec0edd52ddbcea2a2e89e174f0206444a61440b40f39704e64dc807a70bd/multidict-6.7.1-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:273d23f4b40f3dce4d6c8a821c741a86dec62cded82e1175ba3d99be128147ed", size = 268140, upload-time = "2026-01-26T02:44:29.588Z" }, + { url = "https://files.pythonhosted.org/packages/b0/73/6e1b01cbeb458807aa0831742232dbdd1fa92bfa33f52a3f176b4ff3dc11/multidict-6.7.1-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9d624335fd4fa1c08a53f8b4be7676ebde19cd092b3895c421045ca87895b429", size = 254277, upload-time = "2026-01-26T02:44:30.902Z" }, + { url = "https://files.pythonhosted.org/packages/6a/b2/5fb8c124d7561a4974c342bc8c778b471ebbeb3cc17df696f034a7e9afe7/multidict-6.7.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:12fad252f8b267cc75b66e8fc51b3079604e8d43a75428ffe193cd9e2195dfd6", size = 252291, upload-time = "2026-01-26T02:44:32.31Z" }, + { url = "https://files.pythonhosted.org/packages/5a/96/51d4e4e06bcce92577fcd488e22600bd38e4fd59c20cb49434d054903bd2/multidict-6.7.1-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:03ede2a6ffbe8ef936b92cb4529f27f42be7f56afcdab5ab739cd5f27fb1cbf9", size = 250156, upload-time = "2026-01-26T02:44:33.734Z" }, + { url = "https://files.pythonhosted.org/packages/db/6b/420e173eec5fba721a50e2a9f89eda89d9c98fded1124f8d5c675f7a0c0f/multidict-6.7.1-cp313-cp313-musllinux_1_2_i686.whl", hash = "sha256:90efbcf47dbe33dcf643a1e400d67d59abeac5db07dc3f27d6bdeae497a2198c", size = 249742, upload-time = "2026-01-26T02:44:35.222Z" }, + { url = "https://files.pythonhosted.org/packages/44/a3/ec5b5bd98f306bc2aa297b8c6f11a46714a56b1e6ef5ebda50a4f5d7c5fb/multidict-6.7.1-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:5c4b9bfc148f5a91be9244d6264c53035c8a0dcd2f51f1c3c6e30e30ebaa1c84", size = 262221, upload-time = "2026-01-26T02:44:36.604Z" }, + { url = "https://files.pythonhosted.org/packages/cd/f7/e8c0d0da0cd1e28d10e624604e1a36bcc3353aaebdfdc3a43c72bc683a12/multidict-6.7.1-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:401c5a650f3add2472d1d288c26deebc540f99e2fb83e9525007a74cd2116f1d", size = 258664, upload-time = "2026-01-26T02:44:38.008Z" }, + { url = "https://files.pythonhosted.org/packages/52/da/151a44e8016dd33feed44f730bd856a66257c1ee7aed4f44b649fb7edeb3/multidict-6.7.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:97891f3b1b3ffbded884e2916cacf3c6fc87b66bb0dde46f7357404750559f33", size = 249490, upload-time = "2026-01-26T02:44:39.386Z" }, + { url = "https://files.pythonhosted.org/packages/87/af/a3b86bf9630b732897f6fc3f4c4714b90aa4361983ccbdcd6c0339b21b0c/multidict-6.7.1-cp313-cp313-win32.whl", hash = "sha256:e1c5988359516095535c4301af38d8a8838534158f649c05dd1050222321bcb3", size = 41695, upload-time = "2026-01-26T02:44:41.318Z" }, + { url = "https://files.pythonhosted.org/packages/b2/35/e994121b0e90e46134673422dd564623f93304614f5d11886b1b3e06f503/multidict-6.7.1-cp313-cp313-win_amd64.whl", hash = "sha256:960c83bf01a95b12b08fd54324a4eb1d5b52c88932b5cba5d6e712bb3ed12eb5", size = 45884, upload-time = "2026-01-26T02:44:42.488Z" }, + { url = "https://files.pythonhosted.org/packages/ca/61/42d3e5dbf661242a69c97ea363f2d7b46c567da8eadef8890022be6e2ab0/multidict-6.7.1-cp313-cp313-win_arm64.whl", hash = "sha256:563fe25c678aaba333d5399408f5ec3c383ca5b663e7f774dd179a520b8144df", size = 43122, upload-time = "2026-01-26T02:44:43.664Z" }, + { url = "https://files.pythonhosted.org/packages/6d/b3/e6b21c6c4f314bb956016b0b3ef2162590a529b84cb831c257519e7fde44/multidict-6.7.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:c76c4bec1538375dad9d452d246ca5368ad6e1c9039dadcf007ae59c70619ea1", size = 83175, upload-time = "2026-01-26T02:44:44.894Z" }, + { url = "https://files.pythonhosted.org/packages/fb/76/23ecd2abfe0957b234f6c960f4ade497f55f2c16aeb684d4ecdbf1c95791/multidict-6.7.1-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:57b46b24b5d5ebcc978da4ec23a819a9402b4228b8a90d9c656422b4bdd8a963", size = 48460, upload-time = "2026-01-26T02:44:46.106Z" }, + { url = "https://files.pythonhosted.org/packages/c4/57/a0ed92b23f3a042c36bc4227b72b97eca803f5f1801c1ab77c8a212d455e/multidict-6.7.1-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:e954b24433c768ce78ab7929e84ccf3422e46deb45a4dc9f93438f8217fa2d34", size = 46930, upload-time = "2026-01-26T02:44:47.278Z" }, + { url = "https://files.pythonhosted.org/packages/b5/66/02ec7ace29162e447f6382c495dc95826bf931d3818799bbef11e8f7df1a/multidict-6.7.1-cp313-cp313t-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:3bd231490fa7217cc832528e1cd8752a96f0125ddd2b5749390f7c3ec8721b65", size = 242582, upload-time = "2026-01-26T02:44:48.604Z" }, + { url = "https://files.pythonhosted.org/packages/58/18/64f5a795e7677670e872673aca234162514696274597b3708b2c0d276cce/multidict-6.7.1-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:253282d70d67885a15c8a7716f3a73edf2d635793ceda8173b9ecc21f2fb8292", size = 250031, upload-time = "2026-01-26T02:44:50.544Z" }, + { url = "https://files.pythonhosted.org/packages/c8/ed/e192291dbbe51a8290c5686f482084d31bcd9d09af24f63358c3d42fd284/multidict-6.7.1-cp313-cp313t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:0b4c48648d7649c9335cf1927a8b87fa692de3dcb15faa676c6a6f1f1aabda43", size = 228596, upload-time = "2026-01-26T02:44:51.951Z" }, + { url = "https://files.pythonhosted.org/packages/1e/7e/3562a15a60cf747397e7f2180b0a11dc0c38d9175a650e75fa1b4d325e15/multidict-6.7.1-cp313-cp313t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:98bc624954ec4d2c7cb074b8eefc2b5d0ce7d482e410df446414355d158fe4ca", size = 257492, upload-time = "2026-01-26T02:44:53.902Z" }, + { url = "https://files.pythonhosted.org/packages/24/02/7d0f9eae92b5249bb50ac1595b295f10e263dd0078ebb55115c31e0eaccd/multidict-6.7.1-cp313-cp313t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:1b99af4d9eec0b49927b4402bcbb58dea89d3e0db8806a4086117019939ad3dd", size = 255899, upload-time = "2026-01-26T02:44:55.316Z" }, + { url = "https://files.pythonhosted.org/packages/00/e3/9b60ed9e23e64c73a5cde95269ef1330678e9c6e34dd4eb6b431b85b5a10/multidict-6.7.1-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6aac4f16b472d5b7dc6f66a0d49dd57b0e0902090be16594dc9ebfd3d17c47e7", size = 247970, upload-time = "2026-01-26T02:44:56.783Z" }, + { url = "https://files.pythonhosted.org/packages/3e/06/538e58a63ed5cfb0bd4517e346b91da32fde409d839720f664e9a4ae4f9d/multidict-6.7.1-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:21f830fe223215dffd51f538e78c172ed7c7f60c9b96a2bf05c4848ad49921c3", size = 245060, upload-time = "2026-01-26T02:44:58.195Z" }, + { url = "https://files.pythonhosted.org/packages/b2/2f/d743a3045a97c895d401e9bd29aaa09b94f5cbdf1bd561609e5a6c431c70/multidict-6.7.1-cp313-cp313t-musllinux_1_2_armv7l.whl", hash = "sha256:f5dd81c45b05518b9aa4da4aa74e1c93d715efa234fd3e8a179df611cc85e5f4", size = 235888, upload-time = "2026-01-26T02:44:59.57Z" }, + { url = "https://files.pythonhosted.org/packages/38/83/5a325cac191ab28b63c52f14f1131f3b0a55ba3b9aa65a6d0bf2a9b921a0/multidict-6.7.1-cp313-cp313t-musllinux_1_2_i686.whl", hash = "sha256:eb304767bca2bb92fb9c5bd33cedc95baee5bb5f6c88e63706533a1c06ad08c8", size = 243554, upload-time = "2026-01-26T02:45:01.054Z" }, + { url = "https://files.pythonhosted.org/packages/20/1f/9d2327086bd15da2725ef6aae624208e2ef828ed99892b17f60c344e57ed/multidict-6.7.1-cp313-cp313t-musllinux_1_2_ppc64le.whl", hash = "sha256:c9035dde0f916702850ef66460bc4239d89d08df4d02023a5926e7446724212c", size = 252341, upload-time = "2026-01-26T02:45:02.484Z" }, + { url = "https://files.pythonhosted.org/packages/e8/2c/2a1aa0280cf579d0f6eed8ee5211c4f1730bd7e06c636ba2ee6aafda302e/multidict-6.7.1-cp313-cp313t-musllinux_1_2_s390x.whl", hash = "sha256:af959b9beeb66c822380f222f0e0a1889331597e81f1ded7f374f3ecb0fd6c52", size = 246391, upload-time = "2026-01-26T02:45:03.862Z" }, + { url = "https://files.pythonhosted.org/packages/e5/03/7ca022ffc36c5a3f6e03b179a5ceb829be9da5783e6fe395f347c0794680/multidict-6.7.1-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:41f2952231456154ee479651491e94118229844dd7226541788be783be2b5108", size = 243422, upload-time = "2026-01-26T02:45:05.296Z" }, + { url = "https://files.pythonhosted.org/packages/dc/1d/b31650eab6c5778aceed46ba735bd97f7c7d2f54b319fa916c0f96e7805b/multidict-6.7.1-cp313-cp313t-win32.whl", hash = "sha256:df9f19c28adcb40b6aae30bbaa1478c389efd50c28d541d76760199fc1037c32", size = 47770, upload-time = "2026-01-26T02:45:06.754Z" }, + { url = "https://files.pythonhosted.org/packages/ac/5b/2d2d1d522e51285bd61b1e20df8f47ae1a9d80839db0b24ea783b3832832/multidict-6.7.1-cp313-cp313t-win_amd64.whl", hash = "sha256:d54ecf9f301853f2c5e802da559604b3e95bb7a3b01a9c295c6ee591b9882de8", size = 53109, upload-time = "2026-01-26T02:45:08.044Z" }, + { url = "https://files.pythonhosted.org/packages/3d/a3/cc409ba012c83ca024a308516703cf339bdc4b696195644a7215a5164a24/multidict-6.7.1-cp313-cp313t-win_arm64.whl", hash = "sha256:5a37ca18e360377cfda1d62f5f382ff41f2b8c4ccb329ed974cc2e1643440118", size = 45573, upload-time = "2026-01-26T02:45:09.349Z" }, + { url = "https://files.pythonhosted.org/packages/91/cc/db74228a8be41884a567e88a62fd589a913708fcf180d029898c17a9a371/multidict-6.7.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:8f333ec9c5eb1b7105e3b84b53141e66ca05a19a605368c55450b6ba208cb9ee", size = 75190, upload-time = "2026-01-26T02:45:10.651Z" }, + { url = "https://files.pythonhosted.org/packages/d5/22/492f2246bb5b534abd44804292e81eeaf835388901f0c574bac4eeec73c5/multidict-6.7.1-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:a407f13c188f804c759fc6a9f88286a565c242a76b27626594c133b82883b5c2", size = 44486, upload-time = "2026-01-26T02:45:11.938Z" }, + { url = "https://files.pythonhosted.org/packages/f1/4f/733c48f270565d78b4544f2baddc2fb2a245e5a8640254b12c36ac7ac68e/multidict-6.7.1-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:0e161ddf326db5577c3a4cc2d8648f81456e8a20d40415541587a71620d7a7d1", size = 43219, upload-time = "2026-01-26T02:45:14.346Z" }, + { url = "https://files.pythonhosted.org/packages/24/bb/2c0c2287963f4259c85e8bcbba9182ced8d7fca65c780c38e99e61629d11/multidict-6.7.1-cp314-cp314-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:1e3a8bb24342a8201d178c3b4984c26ba81a577c80d4d525727427460a50c22d", size = 245132, upload-time = "2026-01-26T02:45:15.712Z" }, + { url = "https://files.pythonhosted.org/packages/a7/f9/44d4b3064c65079d2467888794dea218d1601898ac50222ab8a9a8094460/multidict-6.7.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:97231140a50f5d447d3164f994b86a0bed7cd016e2682f8650d6a9158e14fd31", size = 252420, upload-time = "2026-01-26T02:45:17.293Z" }, + { url = "https://files.pythonhosted.org/packages/8b/13/78f7275e73fa17b24c9a51b0bd9d73ba64bb32d0ed51b02a746eb876abe7/multidict-6.7.1-cp314-cp314-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:6b10359683bd8806a200fd2909e7c8ca3a7b24ec1d8132e483d58e791d881048", size = 233510, upload-time = "2026-01-26T02:45:19.356Z" }, + { url = "https://files.pythonhosted.org/packages/4b/25/8167187f62ae3cbd52da7893f58cb036b47ea3fb67138787c76800158982/multidict-6.7.1-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:283ddac99f7ac25a4acadbf004cb5ae34480bbeb063520f70ce397b281859362", size = 264094, upload-time = "2026-01-26T02:45:20.834Z" }, + { url = "https://files.pythonhosted.org/packages/a1/e7/69a3a83b7b030cf283fb06ce074a05a02322359783424d7edf0f15fe5022/multidict-6.7.1-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:538cec1e18c067d0e6103aa9a74f9e832904c957adc260e61cd9d8cf0c3b3d37", size = 260786, upload-time = "2026-01-26T02:45:22.818Z" }, + { url = "https://files.pythonhosted.org/packages/fe/3b/8ec5074bcfc450fe84273713b4b0a0dd47c0249358f5d82eb8104ffe2520/multidict-6.7.1-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:7eee46ccb30ff48a1e35bb818cc90846c6be2b68240e42a78599166722cea709", size = 248483, upload-time = "2026-01-26T02:45:24.368Z" }, + { url = "https://files.pythonhosted.org/packages/48/5a/d5a99e3acbca0e29c5d9cba8f92ceb15dce78bab963b308ae692981e3a5d/multidict-6.7.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:fa263a02f4f2dd2d11a7b1bb4362aa7cb1049f84a9235d31adf63f30143469a0", size = 248403, upload-time = "2026-01-26T02:45:25.982Z" }, + { url = "https://files.pythonhosted.org/packages/35/48/e58cd31f6c7d5102f2a4bf89f96b9cf7e00b6c6f3d04ecc44417c00a5a3c/multidict-6.7.1-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:2e1425e2f99ec5bd36c15a01b690a1a2456209c5deed58f95469ffb46039ccbb", size = 240315, upload-time = "2026-01-26T02:45:27.487Z" }, + { url = "https://files.pythonhosted.org/packages/94/33/1cd210229559cb90b6786c30676bb0c58249ff42f942765f88793b41fdce/multidict-6.7.1-cp314-cp314-musllinux_1_2_i686.whl", hash = "sha256:497394b3239fc6f0e13a78a3e1b61296e72bf1c5f94b4c4eb80b265c37a131cd", size = 245528, upload-time = "2026-01-26T02:45:28.991Z" }, + { url = "https://files.pythonhosted.org/packages/64/f2/6e1107d226278c876c783056b7db43d800bb64c6131cec9c8dfb6903698e/multidict-6.7.1-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:233b398c29d3f1b9676b4b6f75c518a06fcb2ea0b925119fb2c1bc35c05e1601", size = 258784, upload-time = "2026-01-26T02:45:30.503Z" }, + { url = "https://files.pythonhosted.org/packages/4d/c1/11f664f14d525e4a1b5327a82d4de61a1db604ab34c6603bb3c2cc63ad34/multidict-6.7.1-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:93b1818e4a6e0930454f0f2af7dfce69307ca03cdcfb3739bf4d91241967b6c1", size = 251980, upload-time = "2026-01-26T02:45:32.603Z" }, + { url = "https://files.pythonhosted.org/packages/e1/9f/75a9ac888121d0c5bbd4ecf4eead45668b1766f6baabfb3b7f66a410e231/multidict-6.7.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:f33dc2a3abe9249ea5d8360f969ec7f4142e7ac45ee7014d8f8d5acddf178b7b", size = 243602, upload-time = "2026-01-26T02:45:34.043Z" }, + { url = "https://files.pythonhosted.org/packages/9a/e7/50bf7b004cc8525d80dbbbedfdc7aed3e4c323810890be4413e589074032/multidict-6.7.1-cp314-cp314-win32.whl", hash = "sha256:3ab8b9d8b75aef9df299595d5388b14530839f6422333357af1339443cff777d", size = 40930, upload-time = "2026-01-26T02:45:36.278Z" }, + { url = "https://files.pythonhosted.org/packages/e0/bf/52f25716bbe93745595800f36fb17b73711f14da59ed0bb2eba141bc9f0f/multidict-6.7.1-cp314-cp314-win_amd64.whl", hash = "sha256:5e01429a929600e7dab7b166062d9bb54a5eed752384c7384c968c2afab8f50f", size = 45074, upload-time = "2026-01-26T02:45:37.546Z" }, + { url = "https://files.pythonhosted.org/packages/97/ab/22803b03285fa3a525f48217963da3a65ae40f6a1b6f6cf2768879e208f9/multidict-6.7.1-cp314-cp314-win_arm64.whl", hash = "sha256:4885cb0e817aef5d00a2e8451d4665c1808378dc27c2705f1bf4ef8505c0d2e5", size = 42471, upload-time = "2026-01-26T02:45:38.889Z" }, + { url = "https://files.pythonhosted.org/packages/e0/6d/f9293baa6146ba9507e360ea0292b6422b016907c393e2f63fc40ab7b7b5/multidict-6.7.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:0458c978acd8e6ea53c81eefaddbbee9c6c5e591f41b3f5e8e194780fe026581", size = 82401, upload-time = "2026-01-26T02:45:40.254Z" }, + { url = "https://files.pythonhosted.org/packages/7a/68/53b5494738d83558d87c3c71a486504d8373421c3e0dbb6d0db48ad42ee0/multidict-6.7.1-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:c0abd12629b0af3cf590982c0b413b1e7395cd4ec026f30986818ab95bfaa94a", size = 48143, upload-time = "2026-01-26T02:45:41.635Z" }, + { url = "https://files.pythonhosted.org/packages/37/e8/5284c53310dcdc99ce5d66563f6e5773531a9b9fe9ec7a615e9bc306b05f/multidict-6.7.1-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:14525a5f61d7d0c94b368a42cff4c9a4e7ba2d52e2672a7b23d84dc86fb02b0c", size = 46507, upload-time = "2026-01-26T02:45:42.99Z" }, + { url = "https://files.pythonhosted.org/packages/e4/fc/6800d0e5b3875568b4083ecf5f310dcf91d86d52573160834fb4bfcf5e4f/multidict-6.7.1-cp314-cp314t-manylinux1_i686.manylinux_2_28_i686.manylinux_2_5_i686.whl", hash = "sha256:17307b22c217b4cf05033dabefe68255a534d637c6c9b0cc8382718f87be4262", size = 239358, upload-time = "2026-01-26T02:45:44.376Z" }, + { url = "https://files.pythonhosted.org/packages/41/75/4ad0973179361cdf3a113905e6e088173198349131be2b390f9fa4da5fc6/multidict-6.7.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:7a7e590ff876a3eaf1c02a4dfe0724b6e69a9e9de6d8f556816f29c496046e59", size = 246884, upload-time = "2026-01-26T02:45:47.167Z" }, + { url = "https://files.pythonhosted.org/packages/c3/9c/095bb28b5da139bd41fb9a5d5caff412584f377914bd8787c2aa98717130/multidict-6.7.1-cp314-cp314t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:5fa6a95dfee63893d80a34758cd0e0c118a30b8dcb46372bf75106c591b77889", size = 225878, upload-time = "2026-01-26T02:45:48.698Z" }, + { url = "https://files.pythonhosted.org/packages/07/d0/c0a72000243756e8f5a277b6b514fa005f2c73d481b7d9e47cd4568aa2e4/multidict-6.7.1-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:a0543217a6a017692aa6ae5cc39adb75e587af0f3a82288b1492eb73dd6cc2a4", size = 253542, upload-time = "2026-01-26T02:45:50.164Z" }, + { url = "https://files.pythonhosted.org/packages/c0/6b/f69da15289e384ecf2a68837ec8b5ad8c33e973aa18b266f50fe55f24b8c/multidict-6.7.1-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:f99fe611c312b3c1c0ace793f92464d8cd263cc3b26b5721950d977b006b6c4d", size = 252403, upload-time = "2026-01-26T02:45:51.779Z" }, + { url = "https://files.pythonhosted.org/packages/a2/76/b9669547afa5a1a25cd93eaca91c0da1c095b06b6d2d8ec25b713588d3a1/multidict-6.7.1-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9004d8386d133b7e6135679424c91b0b854d2d164af6ea3f289f8f2761064609", size = 244889, upload-time = "2026-01-26T02:45:53.27Z" }, + { url = "https://files.pythonhosted.org/packages/7e/a9/a50d2669e506dad33cfc45b5d574a205587b7b8a5f426f2fbb2e90882588/multidict-6.7.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:e628ef0e6859ffd8273c69412a2465c4be4a9517d07261b33334b5ec6f3c7489", size = 241982, upload-time = "2026-01-26T02:45:54.919Z" }, + { url = "https://files.pythonhosted.org/packages/c5/bb/1609558ad8b456b4827d3c5a5b775c93b87878fd3117ed3db3423dfbce1b/multidict-6.7.1-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:841189848ba629c3552035a6a7f5bf3b02eb304e9fea7492ca220a8eda6b0e5c", size = 232415, upload-time = "2026-01-26T02:45:56.981Z" }, + { url = "https://files.pythonhosted.org/packages/d8/59/6f61039d2aa9261871e03ab9dc058a550d240f25859b05b67fd70f80d4b3/multidict-6.7.1-cp314-cp314t-musllinux_1_2_i686.whl", hash = "sha256:ce1bbd7d780bb5a0da032e095c951f7014d6b0a205f8318308140f1a6aba159e", size = 240337, upload-time = "2026-01-26T02:45:58.698Z" }, + { url = "https://files.pythonhosted.org/packages/a1/29/fdc6a43c203890dc2ae9249971ecd0c41deaedfe00d25cb6564b2edd99eb/multidict-6.7.1-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:b26684587228afed0d50cf804cc71062cc9c1cdf55051c4c6345d372947b268c", size = 248788, upload-time = "2026-01-26T02:46:00.862Z" }, + { url = "https://files.pythonhosted.org/packages/a9/14/a153a06101323e4cf086ecee3faadba52ff71633d471f9685c42e3736163/multidict-6.7.1-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:9f9af11306994335398293f9958071019e3ab95e9a707dc1383a35613f6abcb9", size = 242842, upload-time = "2026-01-26T02:46:02.824Z" }, + { url = "https://files.pythonhosted.org/packages/41/5f/604ae839e64a4a6efc80db94465348d3b328ee955e37acb24badbcd24d83/multidict-6.7.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:b4938326284c4f1224178a560987b6cf8b4d38458b113d9b8c1db1a836e640a2", size = 240237, upload-time = "2026-01-26T02:46:05.898Z" }, + { url = "https://files.pythonhosted.org/packages/5f/60/c3a5187bf66f6fb546ff4ab8fb5a077cbdd832d7b1908d4365c7f74a1917/multidict-6.7.1-cp314-cp314t-win32.whl", hash = "sha256:98655c737850c064a65e006a3df7c997cd3b220be4ec8fe26215760b9697d4d7", size = 48008, upload-time = "2026-01-26T02:46:07.468Z" }, + { url = "https://files.pythonhosted.org/packages/0c/f7/addf1087b860ac60e6f382240f64fb99f8bfb532bb06f7c542b83c29ca61/multidict-6.7.1-cp314-cp314t-win_amd64.whl", hash = "sha256:497bde6223c212ba11d462853cfa4f0ae6ef97465033e7dc9940cdb3ab5b48e5", size = 53542, upload-time = "2026-01-26T02:46:08.809Z" }, + { url = "https://files.pythonhosted.org/packages/4c/81/4629d0aa32302ef7b2ec65c75a728cc5ff4fa410c50096174c1632e70b3e/multidict-6.7.1-cp314-cp314t-win_arm64.whl", hash = "sha256:2bbd113e0d4af5db41d5ebfe9ccaff89de2120578164f86a5d17d5a576d1e5b2", size = 44719, upload-time = "2026-01-26T02:46:11.146Z" }, + { url = "https://files.pythonhosted.org/packages/81/08/7036c080d7117f28a4af526d794aab6a84463126db031b007717c1a6676e/multidict-6.7.1-py3-none-any.whl", hash = "sha256:55d97cc6dae627efa6a6e548885712d4864b81110ac76fa4e534c03819fa4a56", size = 12319, upload-time = "2026-01-26T02:46:44.004Z" }, +] + +[[package]] +name = "nest-asyncio" +version = "1.6.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/83/f8/51569ac65d696c8ecbee95938f89d4abf00f47d58d48f6fbabfe8f0baefe/nest_asyncio-1.6.0.tar.gz", hash = "sha256:6f172d5449aca15afd6c646851f4e31e02c598d553a667e38cafa997cfec55fe", size = 7418, upload-time = "2024-01-21T14:25:19.227Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/a0/c4/c2971a3ba4c6103a3d10c4b0f24f461ddc027f0f09763220cf35ca1401b3/nest_asyncio-1.6.0-py3-none-any.whl", hash = "sha256:87af6efd6b5e897c81050477ef65c62e2b2f35d51703cae01aff2905b1852e1c", size = 5195, upload-time = "2024-01-21T14:25:17.223Z" }, +] + +[[package]] +name = "networkx" +version = "3.6.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/6a/51/63fe664f3908c97be9d2e4f1158eb633317598cfa6e1fc14af5383f17512/networkx-3.6.1.tar.gz", hash = "sha256:26b7c357accc0c8cde558ad486283728b65b6a95d85ee1cd66bafab4c8168509", size = 2517025, upload-time = "2025-12-08T17:02:39.908Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/9e/c9/b2622292ea83fbb4ec318f5b9ab867d0a28ab43c5717bb85b0a5f6b3b0a4/networkx-3.6.1-py3-none-any.whl", hash = "sha256:d47fbf302e7d9cbbb9e2555a0d267983d2aa476bac30e90dfbe5669bd57f3762", size = 2068504, upload-time = "2025-12-08T17:02:38.159Z" }, +] + +[[package]] +name = "nicegui" +version = "3.14.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "aiofiles" }, + { name = "aiohttp" }, + { name = "certifi" }, + { name = "docutils" }, + { name = "fastapi" }, + { name = "h11" }, + { name = "httpx" }, + { name = "idna" }, + { name = "ifaddr" }, + { name = "itsdangerous" }, + { name = "jinja2" }, + { name = "lxml" }, + { name = "lxml-html-clean" }, + { name = "markdown2" }, + { name = "orjson", marker = "platform_machine != 'i386' and platform_machine != 'i686' and platform_python_implementation != 'PyPy'" }, + { name = "pydantic-core" }, + { name = "pygments" }, + { name = "python-dotenv" }, + { name = "python-engineio" }, + { name = "python-multipart" }, + { name = "python-socketio", extra = ["asyncio-client"] }, + { name = "starlette" }, + { name = "tinycss2" }, + { name = "typing-extensions" }, + { name = "uvicorn", extra = ["standard"] }, + { name = "watchfiles" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/2a/8a/e477a9d7693b19b6941903b26c3e1525634f077102b3c82599466ca6a643/nicegui-3.14.0.tar.gz", hash = "sha256:d581537545aad191757b668f95612f7362ca50fcfe30e82bd9ca424337c7006e", size = 19621934, upload-time = "2026-06-30T14:40:37.937Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/55/65/2675ae3b9e69d51afbb103a053ce656d555b188b4509add5386b4ad4e5de/nicegui-3.14.0-py3-none-any.whl", hash = "sha256:05b1e453350930b253268edee093bf79cd7b9fe2ffab96043f9234722736652d", size = 20204536, upload-time = "2026-06-30T14:40:33.606Z" }, +] + +[[package]] +name = "numpy" +version = "2.4.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/57/fd/0005efbd0af48e55eb3c7208af93f2862d4b1a56cd78e84309a2d959208d/numpy-2.4.2.tar.gz", hash = "sha256:659a6107e31a83c4e33f763942275fd278b21d095094044eb35569e86a21ddae", size = 20723651, upload-time = "2026-01-31T23:13:10.135Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d3/44/71852273146957899753e69986246d6a176061ea183407e95418c2aa4d9a/numpy-2.4.2-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:e7e88598032542bd49af7c4747541422884219056c268823ef6e5e89851c8825", size = 16955478, upload-time = "2026-01-31T23:10:25.623Z" }, + { url = "https://files.pythonhosted.org/packages/74/41/5d17d4058bd0cd96bcbd4d9ff0fb2e21f52702aab9a72e4a594efa18692f/numpy-2.4.2-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:7edc794af8b36ca37ef5fcb5e0d128c7e0595c7b96a2318d1badb6fcd8ee86b1", size = 14965467, upload-time = "2026-01-31T23:10:28.186Z" }, + { url = "https://files.pythonhosted.org/packages/49/48/fb1ce8136c19452ed15f033f8aee91d5defe515094e330ce368a0647846f/numpy-2.4.2-cp311-cp311-macosx_14_0_arm64.whl", hash = "sha256:6e9f61981ace1360e42737e2bae58b27bf28a1b27e781721047d84bd754d32e7", size = 5475172, upload-time = "2026-01-31T23:10:30.848Z" }, + { url = "https://files.pythonhosted.org/packages/40/a9/3feb49f17bbd1300dd2570432961f5c8a4ffeff1db6f02c7273bd020a4c9/numpy-2.4.2-cp311-cp311-macosx_14_0_x86_64.whl", hash = "sha256:cb7bbb88aa74908950d979eeaa24dbdf1a865e3c7e45ff0121d8f70387b55f73", size = 6805145, upload-time = "2026-01-31T23:10:32.352Z" }, + { url = "https://files.pythonhosted.org/packages/3f/39/fdf35cbd6d6e2fcad42fcf85ac04a85a0d0fbfbf34b30721c98d602fd70a/numpy-2.4.2-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4f069069931240b3fc703f1e23df63443dbd6390614c8c44a87d96cd0ec81eb1", size = 15966084, upload-time = "2026-01-31T23:10:34.502Z" }, + { url = "https://files.pythonhosted.org/packages/1b/46/6fa4ea94f1ddf969b2ee941290cca6f1bfac92b53c76ae5f44afe17ceb69/numpy-2.4.2-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:c02ef4401a506fb60b411467ad501e1429a3487abca4664871d9ae0b46c8ba32", size = 16899477, upload-time = "2026-01-31T23:10:37.075Z" }, + { url = "https://files.pythonhosted.org/packages/09/a1/2a424e162b1a14a5bd860a464ab4e07513916a64ab1683fae262f735ccd2/numpy-2.4.2-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:2653de5c24910e49c2b106499803124dde62a5a1fe0eedeaecf4309a5f639390", size = 17323429, upload-time = "2026-01-31T23:10:39.704Z" }, + { url = "https://files.pythonhosted.org/packages/ce/a2/73014149ff250628df72c58204822ac01d768697913881aacf839ff78680/numpy-2.4.2-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:1ae241bbfc6ae276f94a170b14785e561cb5e7f626b6688cf076af4110887413", size = 18635109, upload-time = "2026-01-31T23:10:41.924Z" }, + { url = "https://files.pythonhosted.org/packages/6c/0c/73e8be2f1accd56df74abc1c5e18527822067dced5ec0861b5bb882c2ce0/numpy-2.4.2-cp311-cp311-win32.whl", hash = "sha256:df1b10187212b198dd45fa943d8985a3c8cf854aed4923796e0e019e113a1bda", size = 6237915, upload-time = "2026-01-31T23:10:45.26Z" }, + { url = "https://files.pythonhosted.org/packages/76/ae/e0265e0163cf127c24c3969d29f1c4c64551a1e375d95a13d32eab25d364/numpy-2.4.2-cp311-cp311-win_amd64.whl", hash = "sha256:b9c618d56a29c9cb1c4da979e9899be7578d2e0b3c24d52079c166324c9e8695", size = 12607972, upload-time = "2026-01-31T23:10:47.021Z" }, + { url = "https://files.pythonhosted.org/packages/29/a5/c43029af9b8014d6ea157f192652c50042e8911f4300f8f6ed3336bf437f/numpy-2.4.2-cp311-cp311-win_arm64.whl", hash = "sha256:47c5a6ed21d9452b10227e5e8a0e1c22979811cad7dcc19d8e3e2fb8fa03f1a3", size = 10485763, upload-time = "2026-01-31T23:10:50.087Z" }, + { url = "https://files.pythonhosted.org/packages/51/6e/6f394c9c77668153e14d4da83bcc247beb5952f6ead7699a1a2992613bea/numpy-2.4.2-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:21982668592194c609de53ba4933a7471880ccbaadcc52352694a59ecc860b3a", size = 16667963, upload-time = "2026-01-31T23:10:52.147Z" }, + { url = "https://files.pythonhosted.org/packages/1f/f8/55483431f2b2fd015ae6ed4fe62288823ce908437ed49db5a03d15151678/numpy-2.4.2-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:40397bda92382fcec844066efb11f13e1c9a3e2a8e8f318fb72ed8b6db9f60f1", size = 14693571, upload-time = "2026-01-31T23:10:54.789Z" }, + { url = "https://files.pythonhosted.org/packages/2f/20/18026832b1845cdc82248208dd929ca14c9d8f2bac391f67440707fff27c/numpy-2.4.2-cp312-cp312-macosx_14_0_arm64.whl", hash = "sha256:b3a24467af63c67829bfaa61eecf18d5432d4f11992688537be59ecd6ad32f5e", size = 5203469, upload-time = "2026-01-31T23:10:57.343Z" }, + { url = "https://files.pythonhosted.org/packages/7d/33/2eb97c8a77daaba34eaa3fa7241a14ac5f51c46a6bd5911361b644c4a1e2/numpy-2.4.2-cp312-cp312-macosx_14_0_x86_64.whl", hash = "sha256:805cc8de9fd6e7a22da5aed858e0ab16be5a4db6c873dde1d7451c541553aa27", size = 6550820, upload-time = "2026-01-31T23:10:59.429Z" }, + { url = "https://files.pythonhosted.org/packages/b1/91/b97fdfd12dc75b02c44e26c6638241cc004d4079a0321a69c62f51470c4c/numpy-2.4.2-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6d82351358ffbcdcd7b686b90742a9b86632d6c1c051016484fa0b326a0a1548", size = 15663067, upload-time = "2026-01-31T23:11:01.291Z" }, + { url = "https://files.pythonhosted.org/packages/f5/c6/a18e59f3f0b8071cc85cbc8d80cd02d68aa9710170b2553a117203d46936/numpy-2.4.2-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9e35d3e0144137d9fdae62912e869136164534d64a169f86438bc9561b6ad49f", size = 16619782, upload-time = "2026-01-31T23:11:03.669Z" }, + { url = "https://files.pythonhosted.org/packages/b7/83/9751502164601a79e18847309f5ceec0b1446d7b6aa12305759b72cf98b2/numpy-2.4.2-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:adb6ed2ad29b9e15321d167d152ee909ec73395901b70936f029c3bc6d7f4460", size = 17013128, upload-time = "2026-01-31T23:11:05.913Z" }, + { url = "https://files.pythonhosted.org/packages/61/c4/c4066322256ec740acc1c8923a10047818691d2f8aec254798f3dd90f5f2/numpy-2.4.2-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:8906e71fd8afcb76580404e2a950caef2685df3d2a57fe82a86ac8d33cc007ba", size = 18345324, upload-time = "2026-01-31T23:11:08.248Z" }, + { url = "https://files.pythonhosted.org/packages/ab/af/6157aa6da728fa4525a755bfad486ae7e3f76d4c1864138003eb84328497/numpy-2.4.2-cp312-cp312-win32.whl", hash = "sha256:ec055f6dae239a6299cace477b479cca2fc125c5675482daf1dd886933a1076f", size = 5960282, upload-time = "2026-01-31T23:11:10.497Z" }, + { url = "https://files.pythonhosted.org/packages/92/0f/7ceaaeaacb40567071e94dbf2c9480c0ae453d5bb4f52bea3892c39dc83c/numpy-2.4.2-cp312-cp312-win_amd64.whl", hash = "sha256:209fae046e62d0ce6435fcfe3b1a10537e858249b3d9b05829e2a05218296a85", size = 12314210, upload-time = "2026-01-31T23:11:12.176Z" }, + { url = "https://files.pythonhosted.org/packages/2f/a3/56c5c604fae6dd40fa2ed3040d005fca97e91bd320d232ac9931d77ba13c/numpy-2.4.2-cp312-cp312-win_arm64.whl", hash = "sha256:fbde1b0c6e81d56f5dccd95dd4a711d9b95df1ae4009a60887e56b27e8d903fa", size = 10220171, upload-time = "2026-01-31T23:11:14.684Z" }, + { url = "https://files.pythonhosted.org/packages/a1/22/815b9fe25d1d7ae7d492152adbc7226d3eff731dffc38fe970589fcaaa38/numpy-2.4.2-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:25f2059807faea4b077a2b6837391b5d830864b3543627f381821c646f31a63c", size = 16663696, upload-time = "2026-01-31T23:11:17.516Z" }, + { url = "https://files.pythonhosted.org/packages/09/f0/817d03a03f93ba9c6c8993de509277d84e69f9453601915e4a69554102a1/numpy-2.4.2-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:bd3a7a9f5847d2fb8c2c6d1c862fa109c31a9abeca1a3c2bd5a64572955b2979", size = 14688322, upload-time = "2026-01-31T23:11:19.883Z" }, + { url = "https://files.pythonhosted.org/packages/da/b4/f805ab79293c728b9a99438775ce51885fd4f31b76178767cfc718701a39/numpy-2.4.2-cp313-cp313-macosx_14_0_arm64.whl", hash = "sha256:8e4549f8a3c6d13d55041925e912bfd834285ef1dd64d6bc7d542583355e2e98", size = 5198157, upload-time = "2026-01-31T23:11:22.375Z" }, + { url = "https://files.pythonhosted.org/packages/74/09/826e4289844eccdcd64aac27d13b0fd3f32039915dd5b9ba01baae1f436c/numpy-2.4.2-cp313-cp313-macosx_14_0_x86_64.whl", hash = "sha256:aea4f66ff44dfddf8c2cffd66ba6538c5ec67d389285292fe428cb2c738c8aef", size = 6546330, upload-time = "2026-01-31T23:11:23.958Z" }, + { url = "https://files.pythonhosted.org/packages/19/fb/cbfdbfa3057a10aea5422c558ac57538e6acc87ec1669e666d32ac198da7/numpy-2.4.2-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:c3cd545784805de05aafe1dde61752ea49a359ccba9760c1e5d1c88a93bbf2b7", size = 15660968, upload-time = "2026-01-31T23:11:25.713Z" }, + { url = "https://files.pythonhosted.org/packages/04/dc/46066ce18d01645541f0186877377b9371b8fa8017fa8262002b4ef22612/numpy-2.4.2-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:d0d9b7c93578baafcbc5f0b83eaf17b79d345c6f36917ba0c67f45226911d499", size = 16607311, upload-time = "2026-01-31T23:11:28.117Z" }, + { url = "https://files.pythonhosted.org/packages/14/d9/4b5adfc39a43fa6bf918c6d544bc60c05236cc2f6339847fc5b35e6cb5b0/numpy-2.4.2-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:f74f0f7779cc7ae07d1810aab8ac6b1464c3eafb9e283a40da7309d5e6e48fbb", size = 17012850, upload-time = "2026-01-31T23:11:30.888Z" }, + { url = "https://files.pythonhosted.org/packages/b7/20/adb6e6adde6d0130046e6fdfb7675cc62bc2f6b7b02239a09eb58435753d/numpy-2.4.2-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:c7ac672d699bf36275c035e16b65539931347d68b70667d28984c9fb34e07fa7", size = 18334210, upload-time = "2026-01-31T23:11:33.214Z" }, + { url = "https://files.pythonhosted.org/packages/78/0e/0a73b3dff26803a8c02baa76398015ea2a5434d9b8265a7898a6028c1591/numpy-2.4.2-cp313-cp313-win32.whl", hash = "sha256:8e9afaeb0beff068b4d9cd20d322ba0ee1cecfb0b08db145e4ab4dd44a6b5110", size = 5958199, upload-time = "2026-01-31T23:11:35.385Z" }, + { url = "https://files.pythonhosted.org/packages/43/bc/6352f343522fcb2c04dbaf94cb30cca6fd32c1a750c06ad6231b4293708c/numpy-2.4.2-cp313-cp313-win_amd64.whl", hash = "sha256:7df2de1e4fba69a51c06c28f5a3de36731eb9639feb8e1cf7e4a7b0daf4cf622", size = 12310848, upload-time = "2026-01-31T23:11:38.001Z" }, + { url = "https://files.pythonhosted.org/packages/6e/8d/6da186483e308da5da1cc6918ce913dcfe14ffde98e710bfeff2a6158d4e/numpy-2.4.2-cp313-cp313-win_arm64.whl", hash = "sha256:0fece1d1f0a89c16b03442eae5c56dc0be0c7883b5d388e0c03f53019a4bfd71", size = 10221082, upload-time = "2026-01-31T23:11:40.392Z" }, + { url = "https://files.pythonhosted.org/packages/25/a1/9510aa43555b44781968935c7548a8926274f815de42ad3997e9e83680dd/numpy-2.4.2-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:5633c0da313330fd20c484c78cdd3f9b175b55e1a766c4a174230c6b70ad8262", size = 14815866, upload-time = "2026-01-31T23:11:42.495Z" }, + { url = "https://files.pythonhosted.org/packages/36/30/6bbb5e76631a5ae46e7923dd16ca9d3f1c93cfa8d4ed79a129814a9d8db3/numpy-2.4.2-cp313-cp313t-macosx_14_0_arm64.whl", hash = "sha256:d9f64d786b3b1dd742c946c42d15b07497ed14af1a1f3ce840cce27daa0ce913", size = 5325631, upload-time = "2026-01-31T23:11:44.7Z" }, + { url = "https://files.pythonhosted.org/packages/46/00/3a490938800c1923b567b3a15cd17896e68052e2145d8662aaf3e1ffc58f/numpy-2.4.2-cp313-cp313t-macosx_14_0_x86_64.whl", hash = "sha256:b21041e8cb6a1eb5312dd1d2f80a94d91efffb7a06b70597d44f1bd2dfc315ab", size = 6646254, upload-time = "2026-01-31T23:11:46.341Z" }, + { url = "https://files.pythonhosted.org/packages/d3/e9/fac0890149898a9b609caa5af7455a948b544746e4b8fe7c212c8edd71f8/numpy-2.4.2-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:00ab83c56211a1d7c07c25e3217ea6695e50a3e2f255053686b081dc0b091a82", size = 15720138, upload-time = "2026-01-31T23:11:48.082Z" }, + { url = "https://files.pythonhosted.org/packages/ea/5c/08887c54e68e1e28df53709f1893ce92932cc6f01f7c3d4dc952f61ffd4e/numpy-2.4.2-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:2fb882da679409066b4603579619341c6d6898fc83a8995199d5249f986e8e8f", size = 16655398, upload-time = "2026-01-31T23:11:50.293Z" }, + { url = "https://files.pythonhosted.org/packages/4d/89/253db0fa0e66e9129c745e4ef25631dc37d5f1314dad2b53e907b8538e6d/numpy-2.4.2-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:66cb9422236317f9d44b67b4d18f44efe6e9c7f8794ac0462978513359461554", size = 17079064, upload-time = "2026-01-31T23:11:52.927Z" }, + { url = "https://files.pythonhosted.org/packages/2a/d5/cbade46ce97c59c6c3da525e8d95b7abe8a42974a1dc5c1d489c10433e88/numpy-2.4.2-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:0f01dcf33e73d80bd8dc0f20a71303abbafa26a19e23f6b68d1aa9990af90257", size = 18379680, upload-time = "2026-01-31T23:11:55.22Z" }, + { url = "https://files.pythonhosted.org/packages/40/62/48f99ae172a4b63d981babe683685030e8a3df4f246c893ea5c6ef99f018/numpy-2.4.2-cp313-cp313t-win32.whl", hash = "sha256:52b913ec40ff7ae845687b0b34d8d93b60cb66dcee06996dd5c99f2fc9328657", size = 6082433, upload-time = "2026-01-31T23:11:58.096Z" }, + { url = "https://files.pythonhosted.org/packages/07/38/e054a61cfe48ad9f1ed0d188e78b7e26859d0b60ef21cd9de4897cdb5326/numpy-2.4.2-cp313-cp313t-win_amd64.whl", hash = "sha256:5eea80d908b2c1f91486eb95b3fb6fab187e569ec9752ab7d9333d2e66bf2d6b", size = 12451181, upload-time = "2026-01-31T23:11:59.782Z" }, + { url = "https://files.pythonhosted.org/packages/6e/a4/a05c3a6418575e185dd84d0b9680b6bb2e2dc3e4202f036b7b4e22d6e9dc/numpy-2.4.2-cp313-cp313t-win_arm64.whl", hash = "sha256:fd49860271d52127d61197bb50b64f58454e9f578cb4b2c001a6de8b1f50b0b1", size = 10290756, upload-time = "2026-01-31T23:12:02.438Z" }, + { url = "https://files.pythonhosted.org/packages/18/88/b7df6050bf18fdcfb7046286c6535cabbdd2064a3440fca3f069d319c16e/numpy-2.4.2-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:444be170853f1f9d528428eceb55f12918e4fda5d8805480f36a002f1415e09b", size = 16663092, upload-time = "2026-01-31T23:12:04.521Z" }, + { url = "https://files.pythonhosted.org/packages/25/7a/1fee4329abc705a469a4afe6e69b1ef7e915117747886327104a8493a955/numpy-2.4.2-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:d1240d50adff70c2a88217698ca844723068533f3f5c5fa6ee2e3220e3bdb000", size = 14698770, upload-time = "2026-01-31T23:12:06.96Z" }, + { url = "https://files.pythonhosted.org/packages/fb/0b/f9e49ba6c923678ad5bc38181c08ac5e53b7a5754dbca8e581aa1a56b1ff/numpy-2.4.2-cp314-cp314-macosx_14_0_arm64.whl", hash = "sha256:7cdde6de52fb6664b00b056341265441192d1291c130e99183ec0d4b110ff8b1", size = 5208562, upload-time = "2026-01-31T23:12:09.632Z" }, + { url = "https://files.pythonhosted.org/packages/7d/12/d7de8f6f53f9bb76997e5e4c069eda2051e3fe134e9181671c4391677bb2/numpy-2.4.2-cp314-cp314-macosx_14_0_x86_64.whl", hash = "sha256:cda077c2e5b780200b6b3e09d0b42205a3d1c68f30c6dceb90401c13bff8fe74", size = 6543710, upload-time = "2026-01-31T23:12:11.969Z" }, + { url = "https://files.pythonhosted.org/packages/09/63/c66418c2e0268a31a4cf8a8b512685748200f8e8e8ec6c507ce14e773529/numpy-2.4.2-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d30291931c915b2ab5717c2974bb95ee891a1cf22ebc16a8006bd59cd210d40a", size = 15677205, upload-time = "2026-01-31T23:12:14.33Z" }, + { url = "https://files.pythonhosted.org/packages/5d/6c/7f237821c9642fb2a04d2f1e88b4295677144ca93285fd76eff3bcba858d/numpy-2.4.2-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:bba37bc29d4d85761deed3954a1bc62be7cf462b9510b51d367b769a8c8df325", size = 16611738, upload-time = "2026-01-31T23:12:16.525Z" }, + { url = "https://files.pythonhosted.org/packages/c2/a7/39c4cdda9f019b609b5c473899d87abff092fc908cfe4d1ecb2fcff453b0/numpy-2.4.2-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:b2f0073ed0868db1dcd86e052d37279eef185b9c8db5bf61f30f46adac63c909", size = 17028888, upload-time = "2026-01-31T23:12:19.306Z" }, + { url = "https://files.pythonhosted.org/packages/da/b3/e84bb64bdfea967cc10950d71090ec2d84b49bc691df0025dddb7c26e8e3/numpy-2.4.2-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:7f54844851cdb630ceb623dcec4db3240d1ac13d4990532446761baede94996a", size = 18339556, upload-time = "2026-01-31T23:12:21.816Z" }, + { url = "https://files.pythonhosted.org/packages/88/f5/954a291bc1192a27081706862ac62bb5920fbecfbaa302f64682aa90beed/numpy-2.4.2-cp314-cp314-win32.whl", hash = "sha256:12e26134a0331d8dbd9351620f037ec470b7c75929cb8a1537f6bfe411152a1a", size = 6006899, upload-time = "2026-01-31T23:12:24.14Z" }, + { url = "https://files.pythonhosted.org/packages/05/cb/eff72a91b2efdd1bc98b3b8759f6a1654aa87612fc86e3d87d6fe4f948c4/numpy-2.4.2-cp314-cp314-win_amd64.whl", hash = "sha256:068cdb2d0d644cdb45670810894f6a0600797a69c05f1ac478e8d31670b8ee75", size = 12443072, upload-time = "2026-01-31T23:12:26.33Z" }, + { url = "https://files.pythonhosted.org/packages/37/75/62726948db36a56428fce4ba80a115716dc4fad6a3a4352487f8bb950966/numpy-2.4.2-cp314-cp314-win_arm64.whl", hash = "sha256:6ed0be1ee58eef41231a5c943d7d1375f093142702d5723ca2eb07db9b934b05", size = 10494886, upload-time = "2026-01-31T23:12:28.488Z" }, + { url = "https://files.pythonhosted.org/packages/36/2f/ee93744f1e0661dc267e4b21940870cabfae187c092e1433b77b09b50ac4/numpy-2.4.2-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:98f16a80e917003a12c0580f97b5f875853ebc33e2eaa4bccfc8201ac6869308", size = 14818567, upload-time = "2026-01-31T23:12:30.709Z" }, + { url = "https://files.pythonhosted.org/packages/a7/24/6535212add7d76ff938d8bdc654f53f88d35cddedf807a599e180dcb8e66/numpy-2.4.2-cp314-cp314t-macosx_14_0_arm64.whl", hash = "sha256:20abd069b9cda45874498b245c8015b18ace6de8546bf50dfa8cea1696ed06ef", size = 5328372, upload-time = "2026-01-31T23:12:32.962Z" }, + { url = "https://files.pythonhosted.org/packages/5e/9d/c48f0a035725f925634bf6b8994253b43f2047f6778a54147d7e213bc5a7/numpy-2.4.2-cp314-cp314t-macosx_14_0_x86_64.whl", hash = "sha256:e98c97502435b53741540a5717a6749ac2ada901056c7db951d33e11c885cc7d", size = 6649306, upload-time = "2026-01-31T23:12:34.797Z" }, + { url = "https://files.pythonhosted.org/packages/81/05/7c73a9574cd4a53a25907bad38b59ac83919c0ddc8234ec157f344d57d9a/numpy-2.4.2-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:da6cad4e82cb893db4b69105c604d805e0c3ce11501a55b5e9f9083b47d2ffe8", size = 15722394, upload-time = "2026-01-31T23:12:36.565Z" }, + { url = "https://files.pythonhosted.org/packages/35/fa/4de10089f21fc7d18442c4a767ab156b25c2a6eaf187c0db6d9ecdaeb43f/numpy-2.4.2-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9e4424677ce4b47fe73c8b5556d876571f7c6945d264201180db2dc34f676ab5", size = 16653343, upload-time = "2026-01-31T23:12:39.188Z" }, + { url = "https://files.pythonhosted.org/packages/b8/f9/d33e4ffc857f3763a57aa85650f2e82486832d7492280ac21ba9efda80da/numpy-2.4.2-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:2b8f157c8a6f20eb657e240f8985cc135598b2b46985c5bccbde7616dc9c6b1e", size = 17078045, upload-time = "2026-01-31T23:12:42.041Z" }, + { url = "https://files.pythonhosted.org/packages/c8/b8/54bdb43b6225badbea6389fa038c4ef868c44f5890f95dd530a218706da3/numpy-2.4.2-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:5daf6f3914a733336dab21a05cdec343144600e964d2fcdabaac0c0269874b2a", size = 18380024, upload-time = "2026-01-31T23:12:44.331Z" }, + { url = "https://files.pythonhosted.org/packages/a5/55/6e1a61ded7af8df04016d81b5b02daa59f2ea9252ee0397cb9f631efe9e5/numpy-2.4.2-cp314-cp314t-win32.whl", hash = "sha256:8c50dd1fc8826f5b26a5ee4d77ca55d88a895f4e4819c7ecc2a9f5905047a443", size = 6153937, upload-time = "2026-01-31T23:12:47.229Z" }, + { url = "https://files.pythonhosted.org/packages/45/aa/fa6118d1ed6d776b0983f3ceac9b1a5558e80df9365b1c3aa6d42bf9eee4/numpy-2.4.2-cp314-cp314t-win_amd64.whl", hash = "sha256:fcf92bee92742edd401ba41135185866f7026c502617f422eb432cfeca4fe236", size = 12631844, upload-time = "2026-01-31T23:12:48.997Z" }, + { url = "https://files.pythonhosted.org/packages/32/0a/2ec5deea6dcd158f254a7b372fb09cfba5719419c8d66343bab35237b3fb/numpy-2.4.2-cp314-cp314t-win_arm64.whl", hash = "sha256:1f92f53998a17265194018d1cc321b2e96e900ca52d54c7c77837b71b9465181", size = 10565379, upload-time = "2026-01-31T23:12:51.345Z" }, + { url = "https://files.pythonhosted.org/packages/f4/f8/50e14d36d915ef64d8f8bc4a087fc8264d82c785eda6711f80ab7e620335/numpy-2.4.2-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:89f7268c009bc492f506abd6f5265defa7cb3f7487dc21d357c3d290add45082", size = 16833179, upload-time = "2026-01-31T23:12:53.5Z" }, + { url = "https://files.pythonhosted.org/packages/17/17/809b5cad63812058a8189e91a1e2d55a5a18fd04611dbad244e8aeae465c/numpy-2.4.2-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:e6dee3bb76aa4009d5a912180bf5b2de012532998d094acee25d9cb8dee3e44a", size = 14889755, upload-time = "2026-01-31T23:12:55.933Z" }, + { url = "https://files.pythonhosted.org/packages/3e/ea/181b9bcf7627fc8371720316c24db888dcb9829b1c0270abf3d288b2e29b/numpy-2.4.2-pp311-pypy311_pp73-macosx_14_0_arm64.whl", hash = "sha256:cd2bd2bbed13e213d6b55dc1d035a4f91748a7d3edc9480c13898b0353708920", size = 5399500, upload-time = "2026-01-31T23:12:58.671Z" }, + { url = "https://files.pythonhosted.org/packages/33/9f/413adf3fc955541ff5536b78fcf0754680b3c6d95103230252a2c9408d23/numpy-2.4.2-pp311-pypy311_pp73-macosx_14_0_x86_64.whl", hash = "sha256:cf28c0c1d4c4bf00f509fa7eb02c58d7caf221b50b467bcb0d9bbf1584d5c821", size = 6714252, upload-time = "2026-01-31T23:13:00.518Z" }, + { url = "https://files.pythonhosted.org/packages/91/da/643aad274e29ccbdf42ecd94dafe524b81c87bcb56b83872d54827f10543/numpy-2.4.2-pp311-pypy311_pp73-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e04ae107ac591763a47398bb45b568fc38f02dbc4aa44c063f67a131f99346cb", size = 15797142, upload-time = "2026-01-31T23:13:02.219Z" }, + { url = "https://files.pythonhosted.org/packages/66/27/965b8525e9cb5dc16481b30a1b3c21e50c7ebf6e9dbd48d0c4d0d5089c7e/numpy-2.4.2-pp311-pypy311_pp73-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:602f65afdef699cda27ec0b9224ae5dc43e328f4c24c689deaf77133dbee74d0", size = 16727979, upload-time = "2026-01-31T23:13:04.62Z" }, + { url = "https://files.pythonhosted.org/packages/de/e5/b7d20451657664b07986c2f6e3be564433f5dcaf3482d68eaecd79afaf03/numpy-2.4.2-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:be71bf1edb48ebbbf7f6337b5bfd2f895d1902f6335a5830b20141fc126ffba0", size = 12502577, upload-time = "2026-01-31T23:13:07.08Z" }, +] + +[[package]] +name = "numpydoc" +version = "1.10.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/e9/3c/dfccc9e7dee357fb2aa13c3890d952a370dd0ed071e0f7ed62ed0df567c1/numpydoc-1.10.0.tar.gz", hash = "sha256:3f7970f6eee30912260a6b31ac72bba2432830cd6722569ec17ee8d3ef5ffa01", size = 94027, upload-time = "2025-12-02T16:39:12.937Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/62/5e/3a6a3e90f35cea3853c45e5d5fb9b7192ce4384616f932cf7591298ab6e1/numpydoc-1.10.0-py3-none-any.whl", hash = "sha256:3149da9874af890bcc2a82ef7aae5484e5aa81cb2778f08e3c307ba6d963721b", size = 69255, upload-time = "2025-12-02T16:39:11.561Z" }, +] + +[[package]] +name = "nvidia-cublas-cu12" +version = "12.8.4.1" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/dc/61/e24b560ab2e2eaeb3c839129175fb330dfcfc29e5203196e5541a4c44682/nvidia_cublas_cu12-12.8.4.1-py3-none-manylinux_2_27_x86_64.whl", hash = "sha256:8ac4e771d5a348c551b2a426eda6193c19aa630236b418086020df5ba9667142", size = 594346921, upload-time = "2025-03-07T01:44:31.254Z" }, +] + +[[package]] +name = "nvidia-cuda-cupti-cu12" +version = "12.8.90" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f8/02/2adcaa145158bf1a8295d83591d22e4103dbfd821bcaf6f3f53151ca4ffa/nvidia_cuda_cupti_cu12-12.8.90-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:ea0cb07ebda26bb9b29ba82cda34849e73c166c18162d3913575b0c9db9a6182", size = 10248621, upload-time = "2025-03-07T01:40:21.213Z" }, +] + +[[package]] +name = "nvidia-cuda-nvrtc-cu12" +version = "12.8.93" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/05/6b/32f747947df2da6994e999492ab306a903659555dddc0fbdeb9d71f75e52/nvidia_cuda_nvrtc_cu12-12.8.93-py3-none-manylinux2010_x86_64.manylinux_2_12_x86_64.whl", hash = "sha256:a7756528852ef889772a84c6cd89d41dfa74667e24cca16bb31f8f061e3e9994", size = 88040029, upload-time = "2025-03-07T01:42:13.562Z" }, +] + +[[package]] +name = "nvidia-cuda-runtime-cu12" +version = "12.8.90" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0d/9b/a997b638fcd068ad6e4d53b8551a7d30fe8b404d6f1804abf1df69838932/nvidia_cuda_runtime_cu12-12.8.90-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:adade8dcbd0edf427b7204d480d6066d33902cab2a4707dcfc48a2d0fd44ab90", size = 954765, upload-time = "2025-03-07T01:40:01.615Z" }, +] + +[[package]] +name = "nvidia-cudnn-cu12" +version = "9.10.2.21" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "nvidia-cublas-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/ba/51/e123d997aa098c61d029f76663dedbfb9bc8dcf8c60cbd6adbe42f76d049/nvidia_cudnn_cu12-9.10.2.21-py3-none-manylinux_2_27_x86_64.whl", hash = "sha256:949452be657fa16687d0930933f032835951ef0892b37d2d53824d1a84dc97a8", size = 706758467, upload-time = "2025-06-06T21:54:08.597Z" }, +] + +[[package]] +name = "nvidia-cufft-cu12" +version = "11.3.3.83" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "nvidia-nvjitlink-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/1f/13/ee4e00f30e676b66ae65b4f08cb5bcbb8392c03f54f2d5413ea99a5d1c80/nvidia_cufft_cu12-11.3.3.83-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:4d2dd21ec0b88cf61b62e6b43564355e5222e4a3fb394cac0db101f2dd0d4f74", size = 193118695, upload-time = "2025-03-07T01:45:27.821Z" }, +] + +[[package]] +name = "nvidia-cufile-cu12" +version = "1.13.1.3" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/bb/fe/1bcba1dfbfb8d01be8d93f07bfc502c93fa23afa6fd5ab3fc7c1df71038a/nvidia_cufile_cu12-1.13.1.3-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:1d069003be650e131b21c932ec3d8969c1715379251f8d23a1860554b1cb24fc", size = 1197834, upload-time = "2025-03-07T01:45:50.723Z" }, +] + +[[package]] +name = "nvidia-curand-cu12" +version = "10.3.9.90" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/fb/aa/6584b56dc84ebe9cf93226a5cde4d99080c8e90ab40f0c27bda7a0f29aa1/nvidia_curand_cu12-10.3.9.90-py3-none-manylinux_2_27_x86_64.whl", hash = "sha256:b32331d4f4df5d6eefa0554c565b626c7216f87a06a4f56fab27c3b68a830ec9", size = 63619976, upload-time = "2025-03-07T01:46:23.323Z" }, +] + +[[package]] +name = "nvidia-cusolver-cu12" +version = "11.7.3.90" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "nvidia-cublas-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "nvidia-cusparse-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "nvidia-nvjitlink-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/85/48/9a13d2975803e8cf2777d5ed57b87a0b6ca2cc795f9a4f59796a910bfb80/nvidia_cusolver_cu12-11.7.3.90-py3-none-manylinux_2_27_x86_64.whl", hash = "sha256:4376c11ad263152bd50ea295c05370360776f8c3427b30991df774f9fb26c450", size = 267506905, upload-time = "2025-03-07T01:47:16.273Z" }, +] + +[[package]] +name = "nvidia-cusparse-cu12" +version = "12.5.8.93" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "nvidia-nvjitlink-cu12", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/c2/f5/e1854cb2f2bcd4280c44736c93550cc300ff4b8c95ebe370d0aa7d2b473d/nvidia_cusparse_cu12-12.5.8.93-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:1ec05d76bbbd8b61b06a80e1eaf8cf4959c3d4ce8e711b65ebd0443bb0ebb13b", size = 288216466, upload-time = "2025-03-07T01:48:13.779Z" }, +] + +[[package]] +name = "nvidia-cusparselt-cu12" +version = "0.7.1" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/56/79/12978b96bd44274fe38b5dde5cfb660b1d114f70a65ef962bcbbed99b549/nvidia_cusparselt_cu12-0.7.1-py3-none-manylinux2014_x86_64.whl", hash = "sha256:f1bb701d6b930d5a7cea44c19ceb973311500847f81b634d802b7b539dc55623", size = 287193691, upload-time = "2025-02-26T00:15:44.104Z" }, +] + +[[package]] +name = "nvidia-nccl-cu12" +version = "2.27.5" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/6e/89/f7a07dc961b60645dbbf42e80f2bc85ade7feb9a491b11a1e973aa00071f/nvidia_nccl_cu12-2.27.5-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:ad730cf15cb5d25fe849c6e6ca9eb5b76db16a80f13f425ac68d8e2e55624457", size = 322348229, upload-time = "2025-06-26T04:11:28.385Z" }, +] + +[[package]] +name = "nvidia-nvjitlink-cu12" +version = "12.8.93" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f6/74/86a07f1d0f42998ca31312f998bd3b9a7eff7f52378f4f270c8679c77fb9/nvidia_nvjitlink_cu12-12.8.93-py3-none-manylinux2010_x86_64.manylinux_2_12_x86_64.whl", hash = "sha256:81ff63371a7ebd6e6451970684f916be2eab07321b73c9d244dc2b4da7f73b88", size = 39254836, upload-time = "2025-03-07T01:49:55.661Z" }, +] + +[[package]] +name = "nvidia-nvshmem-cu12" +version = "3.4.5" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b5/09/6ea3ea725f82e1e76684f0708bbedd871fc96da89945adeba65c3835a64c/nvidia_nvshmem_cu12-3.4.5-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:042f2500f24c021db8a06c5eec2539027d57460e1c1a762055a6554f72c369bd", size = 139103095, upload-time = "2025-09-06T00:32:31.266Z" }, +] + +[[package]] +name = "nvidia-nvtx-cu12" +version = "12.8.90" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/a2/eb/86626c1bbc2edb86323022371c39aa48df6fd8b0a1647bc274577f72e90b/nvidia_nvtx_cu12-12.8.90-py3-none-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:5b17e2001cc0d751a5bc2c6ec6d26ad95913324a4adb86788c944f8ce9ba441f", size = 89954, upload-time = "2025-03-07T01:42:44.131Z" }, +] + +[[package]] +name = "onnx" +version = "1.20.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "ml-dtypes" }, + { name = "numpy" }, + { name = "protobuf" }, + { name = "typing-extensions" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/3b/8a/335c03a8683a88a32f9a6bb98899ea6df241a41df64b37b9696772414794/onnx-1.20.1.tar.gz", hash = "sha256:ded16de1df563d51fbc1ad885f2a426f814039d8b5f4feb77febe09c0295ad67", size = 12048980, upload-time = "2026-01-10T01:40:03.043Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0c/38/1a0e74d586c08833404100f5c052f92732fb5be417c0b2d7cb0838443bfe/onnx-1.20.1-cp311-cp311-macosx_12_0_universal2.whl", hash = "sha256:53426e1b458641e7a537e9f176330012ff59d90206cac1c1a9d03cdd73ed3095", size = 17904965, upload-time = "2026-01-10T01:39:13.532Z" }, + { url = "https://files.pythonhosted.org/packages/96/25/64b076e9684d17335f80b15b3bf502f7a8e1a89f08a6b208d4f2861b3011/onnx-1.20.1-cp311-cp311-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ca7281f8c576adf396c338cf43fff26faee8d4d2e2577b8e73738f37ceccf945", size = 17415179, upload-time = "2026-01-10T01:39:16.516Z" }, + { url = "https://files.pythonhosted.org/packages/ac/d5/6743b409421ced20ad5af1b3a7b4c4e568689ffaca86db431692fca409a6/onnx-1.20.1-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:2297f428c51c7fc6d8fad0cf34384284dfeff3f86799f8e83ef905451348ade0", size = 17513672, upload-time = "2026-01-10T01:39:19.35Z" }, + { url = "https://files.pythonhosted.org/packages/9a/6b/dae82e6fdb2043302f29adca37522312ea2be55b75907b59be06fbdffe87/onnx-1.20.1-cp311-cp311-win32.whl", hash = "sha256:63d9cbcab8c96841eadeb7c930e07bfab4dde8081eb76fb68e0dfb222706b81e", size = 16239336, upload-time = "2026-01-10T01:39:22.506Z" }, + { url = "https://files.pythonhosted.org/packages/8e/17/a0d7863390c1f2067d7c02dcc1477034965c32aaa1407bfcf775305ffee4/onnx-1.20.1-cp311-cp311-win_amd64.whl", hash = "sha256:d78cde72d7ca8356a2d99c5dc0dbf67264254828cae2c5780184486c0cd7b3bf", size = 16392120, upload-time = "2026-01-10T01:39:25.106Z" }, + { url = "https://files.pythonhosted.org/packages/aa/72/9b879a46eb7a3322223791f36bf9c25d95da9ed93779eabb75a560f22e5b/onnx-1.20.1-cp311-cp311-win_arm64.whl", hash = "sha256:0104bb2d4394c179bcea3df7599a45a2932b80f4633840896fcf0d7d8daecea2", size = 16346923, upload-time = "2026-01-10T01:39:27.782Z" }, + { url = "https://files.pythonhosted.org/packages/7c/4c/4b17e82f91ab9aa07ff595771e935ca73547b035030dc5f5a76e63fbfea9/onnx-1.20.1-cp312-abi3-macosx_12_0_universal2.whl", hash = "sha256:1d923bb4f0ce1b24c6859222a7e6b2f123e7bfe7623683662805f2e7b9e95af2", size = 17903547, upload-time = "2026-01-10T01:39:31.015Z" }, + { url = "https://files.pythonhosted.org/packages/64/5e/1bfa100a9cb3f2d3d5f2f05f52f7e60323b0e20bb0abace1ae64dbc88f25/onnx-1.20.1-cp312-abi3-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ddc0b7d8b5a94627dc86c533d5e415af94cbfd103019a582669dad1f56d30281", size = 17412021, upload-time = "2026-01-10T01:39:33.885Z" }, + { url = "https://files.pythonhosted.org/packages/fb/71/d3fec0dcf9a7a99e7368112d9c765154e81da70fcba1e3121131a45c245b/onnx-1.20.1-cp312-abi3-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9336b6b8e6efcf5c490a845f6afd7e041c89a56199aeda384ed7d58fb953b080", size = 17510450, upload-time = "2026-01-10T01:39:36.589Z" }, + { url = "https://files.pythonhosted.org/packages/74/a7/edce1403e05a46e59b502fae8e3350ceeac5841f8e8f1561e98562ed9b09/onnx-1.20.1-cp312-abi3-win32.whl", hash = "sha256:564c35a94811979808ab5800d9eb4f3f32c12daedba7e33ed0845f7c61ef2431", size = 16238216, upload-time = "2026-01-10T01:39:39.46Z" }, + { url = "https://files.pythonhosted.org/packages/8b/c7/8690c81200ae652ac550c1df52f89d7795e6cc941f3cb38c9ef821419e80/onnx-1.20.1-cp312-abi3-win_amd64.whl", hash = "sha256:9fe7f9a633979d50984b94bda8ceb7807403f59a341d09d19342dc544d0ca1d5", size = 16389207, upload-time = "2026-01-10T01:39:41.955Z" }, + { url = "https://files.pythonhosted.org/packages/01/a0/4fb0e6d36eaf079af366b2c1f68bafe92df6db963e2295da84388af64abc/onnx-1.20.1-cp312-abi3-win_arm64.whl", hash = "sha256:21d747348b1c8207406fa2f3e12b82f53e0d5bb3958bcd0288bd27d3cb6ebb00", size = 16344155, upload-time = "2026-01-10T01:39:45.536Z" }, + { url = "https://files.pythonhosted.org/packages/ea/bb/715fad292b255664f0e603f1b2ef7bf2b386281775f37406beb99fa05957/onnx-1.20.1-cp313-cp313t-macosx_12_0_universal2.whl", hash = "sha256:29197b768f5acdd1568ddeb0a376407a2817844f6ac1ef8c8dd2d974c9ab27c3", size = 17912296, upload-time = "2026-01-10T01:39:48.21Z" }, + { url = "https://files.pythonhosted.org/packages/2d/c3/541af12c3d45e159a94ee701100ba9e94b7bd8b7a8ac5ca6838569f894f8/onnx-1.20.1-cp313-cp313t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:1f0371aa67f51917a09cc829ada0f9a79a58f833449e03d748f7f7f53787c43c", size = 17416925, upload-time = "2026-01-10T01:39:50.82Z" }, + { url = "https://files.pythonhosted.org/packages/2c/3b/d5660a7d2ddf14f531ca66d409239f543bb290277c3f14f4b4b78e32efa3/onnx-1.20.1-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:be1e5522200b203b34327b2cf132ddec20ab063469476e1f5b02bb7bd259a489", size = 17515602, upload-time = "2026-01-10T01:39:54.132Z" }, + { url = "https://files.pythonhosted.org/packages/9c/b4/47225ab2a92562eff87ba9a1a028e3535d659a7157d7cde659003998b8e3/onnx-1.20.1-cp313-cp313t-win_amd64.whl", hash = "sha256:15c815313bbc4b2fdc7e4daeb6e26b6012012adc4d850f4e3b09ed327a7ea92a", size = 16395729, upload-time = "2026-01-10T01:39:57.577Z" }, + { url = "https://files.pythonhosted.org/packages/aa/7d/1bbe626ff6b192c844d3ad34356840cc60fca02e2dea0db95e01645758b1/onnx-1.20.1-cp313-cp313t-win_arm64.whl", hash = "sha256:eb335d7bcf9abac82a0d6a0fda0363531ae0b22cfd0fc6304bff32ee29905def", size = 16348968, upload-time = "2026-01-10T01:40:00.491Z" }, +] + +[[package]] +name = "onnx2torch" +version = "1.5.15" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, + { name = "onnx" }, + { name = "torch" }, + { name = "torchvision" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/06/51/bb56a5dfee431aa61f13a297e33f6ae0654e55d3ba93d62b88b673182af3/onnx2torch-1.5.15.tar.gz", hash = "sha256:d2a239cf0871cbbeec13d43e2a72ac2f8b3c8dcf80695e4d1040c3deed2b14a2", size = 49786, upload-time = "2024-08-07T14:04:01.076Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/84/80/cec13a9bcb7525cbd941958037ccb5cd499e8466915130f3d2ee3772d34f/onnx2torch-1.5.15-py3-none-any.whl", hash = "sha256:123258e0f147e07b259cf845c8113c5634b8260e52c5fb26b7d507226732d9e5", size = 80965, upload-time = "2024-08-07T14:04:09.985Z" }, +] + +[[package]] +name = "orjson" +version = "3.11.9" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/7e/0c/964746fcafbd16f8ff53219ad9f6b412b34f345c75f384ad434ceaadb538/orjson-3.11.9.tar.gz", hash = "sha256:4fef17e1f8722c11587a6ef18e35902450221da0028e65dbaaa543619e68e48f", size = 5599163, upload-time = "2026-05-06T15:11:08.309Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1e/51/3fb9e65ae76ee97bd611869a503fa3fc0a6e81dd8b737cf3003f682df7ff/orjson-3.11.9-cp311-cp311-macosx_10_15_x86_64.macosx_11_0_arm64.macosx_10_15_universal2.whl", hash = "sha256:f01c4818b3fc9b0da8e096722a84318071eaa118df35f6ed2344da0e73a5444f", size = 228522, upload-time = "2026-05-06T15:09:35.362Z" }, + { url = "https://files.pythonhosted.org/packages/16/fa/9d54b07cb3f3b0bfd57841478e42d7a0ece4a9f49f9907eecf5a45461687/orjson-3.11.9-cp311-cp311-macosx_15_0_arm64.whl", hash = "sha256:3ebca4179031ee716ed076ffadc29428e900512f6fccee8614c9983157fcf19c", size = 128463, upload-time = "2026-05-06T15:09:37.063Z" }, + { url = "https://files.pythonhosted.org/packages/88/b1/6ceafc2eefd0a553e3be77ce6c49d107e772485d9568629376171c50e634/orjson-3.11.9-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:48ee05097750de0ff69ed5b7bbcf0732182fd57a24043dcc2a1da780a5ead3a5", size = 132306, upload-time = "2026-05-06T15:09:38.299Z" }, + { url = "https://files.pythonhosted.org/packages/ea/76/f11311285324a40aab1e3031385c50b635a7cd0734fdaf60c7e89a696f60/orjson-3.11.9-cp311-cp311-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:a6082706765a95a6680d812e1daf1c0cfe8adec7831b3ff3b625693f3b461b1c", size = 127988, upload-time = "2026-05-06T15:09:39.597Z" }, + { url = "https://files.pythonhosted.org/packages/9e/85/0ef63bcf1337f44031ce9b91b1919563f62a37527b3ea4368bb15a22e5d7/orjson-3.11.9-cp311-cp311-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:277fefe9d76ee17eb14debf399e3533d4d63b5f677a4d3719eb763536af1f4bd", size = 135188, upload-time = "2026-05-06T15:09:40.957Z" }, + { url = "https://files.pythonhosted.org/packages/05/94/b0d27090ea8a2095db3c2bd1b1c96f96f19bbb494d7fef33130e846e613d/orjson-3.11.9-cp311-cp311-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:03db380e3780fa0015ed776a90f20e8e20bb11dde13b216ce19e5718e3dfba62", size = 145937, upload-time = "2026-05-06T15:09:42.249Z" }, + { url = "https://files.pythonhosted.org/packages/09/eb/75d50c29c05b8054013e221e598820a365c8e64065312e75e202ed880709/orjson-3.11.9-cp311-cp311-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:33d7d766701847dc6729846362dc27895d2f2d2251264f9d10e7cb9878194877", size = 132758, upload-time = "2026-05-06T15:09:43.945Z" }, + { url = "https://files.pythonhosted.org/packages/49/bd/360686f39348aa88827cb6fbf7dc606fd41c831a35235e1abf1db8e3a9e6/orjson-3.11.9-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:147302878da387104b66bb4a8b0227d1d487e976ce41a8501916161072ed87b1", size = 133971, upload-time = "2026-05-06T15:09:45.239Z" }, + { url = "https://files.pythonhosted.org/packages/0e/30/3178eb16f3221aeef068b6f1f1ebe05f656ea5c6dffe9f6c917329fe17a3/orjson-3.11.9-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:3513550321f8c8c811a7c3297b8a630e82dc08e4c10216d07703c997776236cd", size = 141685, upload-time = "2026-05-06T15:09:46.858Z" }, + { url = "https://files.pythonhosted.org/packages/5f/f1/ff2f19ed0225f9680fafa42febca3570dd59444ebf190980738d376214c2/orjson-3.11.9-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:c5d001196b89fa9cf0a4ab79766cd835b991a166e4b621ba95089edc50c429ff", size = 415167, upload-time = "2026-05-06T15:09:48.312Z" }, + { url = "https://files.pythonhosted.org/packages/9b/61/863bddf0da6e9e586765414debd54b4e58db05f560902b6d00658cb88636/orjson-3.11.9-cp311-cp311-musllinux_1_2_i686.whl", hash = "sha256:16969c9d369c98eb084889c6e4d2d39b77c7eb38ceccf8da2a9fff62ae908980", size = 147913, upload-time = "2026-05-06T15:09:49.733Z" }, + { url = "https://files.pythonhosted.org/packages/b6/8a/4081492586d75b073d60c5271a8d0f05a0955cabf1e34c8473f6fcd84235/orjson-3.11.9-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:63e0efbc991250c0b3143488fa57d95affcabbfc63c99c48d625dd37779aafe2", size = 136959, upload-time = "2026-05-06T15:09:51.311Z" }, + { url = "https://files.pythonhosted.org/packages/0d/bd/70b6ab193594d7abb875320c0a7c8335e846f28968c432c31042409c3c8d/orjson-3.11.9-cp311-cp311-win32.whl", hash = "sha256:14ed654580c1ed2bc217352ec82f91b047aef82951aa71c7f64e0dcb03c0e180", size = 131533, upload-time = "2026-05-06T15:09:52.637Z" }, + { url = "https://files.pythonhosted.org/packages/3f/17/1a1a228183d62d1b77e2c30d210f47dd4768b310ebe1607c63e3c0e3a71e/orjson-3.11.9-cp311-cp311-win_amd64.whl", hash = "sha256:57ea77fb70a448ce87d18fca050193202a3da5e54598f6501ca5476fb66cfe02", size = 127106, upload-time = "2026-05-06T15:09:54.204Z" }, + { url = "https://files.pythonhosted.org/packages/b8/95/285de5fa296d09681ee9c546cd4a8aeb773b701cf343dc125994f4d52953/orjson-3.11.9-cp311-cp311-win_arm64.whl", hash = "sha256:19b72ed11572a2ee51a67a903afbe5af504f84ed6f529c0fe44b0ab3fb5cc697", size = 126848, upload-time = "2026-05-06T15:09:55.551Z" }, + { url = "https://files.pythonhosted.org/packages/16/6d/11867a3ffa3a3608d84a4de51ef4dd0896d6b5cc9132fbe1daf593e677bc/orjson-3.11.9-cp312-cp312-macosx_10_15_x86_64.macosx_11_0_arm64.macosx_10_15_universal2.whl", hash = "sha256:9ef6fe90aadef185c7b128859f40beb24720b4ecea95379fc9000931179c3a49", size = 228515, upload-time = "2026-05-06T15:09:57.265Z" }, + { url = "https://files.pythonhosted.org/packages/24/75/05912954c8b288f34fcf5cd4b9b071cb4f6e77b9961e175e56ebb258089f/orjson-3.11.9-cp312-cp312-macosx_15_0_arm64.whl", hash = "sha256:e5c9b8f28e726e97d97696c826bc7bea5d71cecd63576dba92924a32c1961291", size = 128409, upload-time = "2026-05-06T15:09:59.063Z" }, + { url = "https://files.pythonhosted.org/packages/ab/86/1c3a47df3bc8191ea9ac51603bbb872a95167a364320c269f2557911f406/orjson-3.11.9-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:26a473dbb4162108b27901492546f83c76fdcea3d0eadff00ae7a07e18dcce09", size = 132106, upload-time = "2026-05-06T15:10:00.798Z" }, + { url = "https://files.pythonhosted.org/packages/d7/cf/b33b5f3e695ae7d63feef9d915c37cc3b8f465493dcd4f8e0b4c697a2366/orjson-3.11.9-cp312-cp312-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:011382e2a60fda9d46f1cdee31068cfc52ffe952b587d683ec0463002802a0f4", size = 127864, upload-time = "2026-05-06T15:10:02.15Z" }, + { url = "https://files.pythonhosted.org/packages/31/6a/6cf69385a58208024fcb8c014e2141b8ce838aba6492b589f8acfff97fab/orjson-3.11.9-cp312-cp312-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:c2d3dc759490128c5c1711a53eeaa8ee1d437fd0038ffd2b6008abf46db3f882", size = 135213, upload-time = "2026-05-06T15:10:03.515Z" }, + { url = "https://files.pythonhosted.org/packages/e8/f8/0b1bd3e8f2efcdd376af5c8cfd79eaf13f018080c0089c80ebd724e3c7fb/orjson-3.11.9-cp312-cp312-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:d8ea516b3726d190e1b4297e6f4e7a8650347ae053868a18163b4dd3641d1fff", size = 145994, upload-time = "2026-05-06T15:10:05.083Z" }, + { url = "https://files.pythonhosted.org/packages/f3/59/dab79f61044c529d2c81aecdc589b1f833a1c8dec11ba3b1c2498a02ca7e/orjson-3.11.9-cp312-cp312-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:380cdce7ba24989af81d0a7013d0aaec5d0e2a21734c0e2681b1bc4f141957fe", size = 132744, upload-time = "2026-05-06T15:10:06.853Z" }, + { url = "https://files.pythonhosted.org/packages/0e/a4/82b7a2fe5d8a67a59ed831b24d59a3d46ea7d207b66e1602d376541d94a6/orjson-3.11.9-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:be4fa4f0af7fa18951f7ab3fc2148e223af211bf03f59e1c6034ec3f97f21d61", size = 134014, upload-time = "2026-05-06T15:10:08.213Z" }, + { url = "https://files.pythonhosted.org/packages/50/c7/375e83a76851b73b2e39f3bcf0e5a19e2b89bad13e5bca97d0b293d27f24/orjson-3.11.9-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:a8f5f8bc7ce7d59f08d9f99fa510c06496164a24cb5f3d34537dbd9ca30132e2", size = 141509, upload-time = "2026-05-06T15:10:09.595Z" }, + { url = "https://files.pythonhosted.org/packages/7f/7c/49d5d82a3d3097f641f094f552131f1e2723b0b8cb0fa2874ab65ecfffa6/orjson-3.11.9-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:4d7fde5501b944f83b3e665e1b31343ff6e154b15560a16b7130ea1e594a4206", size = 415127, upload-time = "2026-05-06T15:10:11.049Z" }, + { url = "https://files.pythonhosted.org/packages/3a/dc/7446c538590d55f455647e5f3c61fc33f7108714e7afcffa6a2a033f8350/orjson-3.11.9-cp312-cp312-musllinux_1_2_i686.whl", hash = "sha256:cde1a448023ba7d5bb4c01c5afb48894380b5e4956e0627266526587ef4e535f", size = 148025, upload-time = "2026-05-06T15:10:12.842Z" }, + { url = "https://files.pythonhosted.org/packages/df/e5/4d2d8af06f788329b4f78f8cc3679bb395392fcaa1e4d8d3c33e85308fa4/orjson-3.11.9-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:71e63adb0e1f1ed5d9e168f50a91ceb93ae6420731d222dc7da5c69409aa47aa", size = 136943, upload-time = "2026-05-06T15:10:14.405Z" }, + { url = "https://files.pythonhosted.org/packages/06/69/850264ccf6d80f6b174620d30a87f65c9b1490aba33fe6b62798e618cad3/orjson-3.11.9-cp312-cp312-win32.whl", hash = "sha256:2d057a602cdd19a0ad680417527c45b6961a095081c0f46fe0e03e304aac6470", size = 131606, upload-time = "2026-05-06T15:10:15.791Z" }, + { url = "https://files.pythonhosted.org/packages/b9/d5/973a43fc9c55e20f2051e9830997649f669be0cb3ca52192087c0143f118/orjson-3.11.9-cp312-cp312-win_amd64.whl", hash = "sha256:59e403b1cc5a676da8eaf31f6254801b7341b3e29efa85f92b48d272637e77be", size = 127101, upload-time = "2026-05-06T15:10:17.129Z" }, + { url = "https://files.pythonhosted.org/packages/fe/ae/495470f0e4a18f73fa10b7f6b84b464ec4cc5291c4e0c7c2a6c400bef006/orjson-3.11.9-cp312-cp312-win_arm64.whl", hash = "sha256:9af678d6488357948f1f84c6cd1c1d397c014e1ae2f98ae082a44eb48f602624", size = 126736, upload-time = "2026-05-06T15:10:18.645Z" }, + { url = "https://files.pythonhosted.org/packages/32/33/93fcc25907235c344ae73122f8a4e01d2d393ef062b4af7d2e2487a32c37/orjson-3.11.9-cp313-cp313-macosx_10_15_x86_64.macosx_11_0_arm64.macosx_10_15_universal2.whl", hash = "sha256:4bab1b2d6141fe7b32ae71dac905666ece4f94936efbfb13d55bb7739a3a6021", size = 228458, upload-time = "2026-05-06T15:10:20.079Z" }, + { url = "https://files.pythonhosted.org/packages/8f/27/b1e6dadb3c080313c03fdd8067b85e6a0460c7d8d6a1c3984ef77b904e4d/orjson-3.11.9-cp313-cp313-macosx_15_0_arm64.whl", hash = "sha256:844417969855fc7a41be124aafe83dc424592a7f77cd4501900c67307122b92c", size = 128368, upload-time = "2026-05-06T15:10:21.549Z" }, + { url = "https://files.pythonhosted.org/packages/21/0f/c9ede0bf052f6b4051e64a7d4fa91b725cccf8321a6a786e86eb03519f00/orjson-3.11.9-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:ffe02797b5e9f3a9d8292ddcd289b474ad13e81ad83cd1891a240811f1d2cb81", size = 132070, upload-time = "2026-05-06T15:10:23.371Z" }, + { url = "https://files.pythonhosted.org/packages/fd/26/d398e28048dc18205bbe812f2c88cb9b40313db2470778e25964796458fe/orjson-3.11.9-cp313-cp313-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:0e4eed3b200023042814d2fc8a5d2e880f13b52e1ed2485e83da4f3962f7dc1a", size = 127892, upload-time = "2026-05-06T15:10:24.714Z" }, + { url = "https://files.pythonhosted.org/packages/66/60/52b0054c4c700d5aa7fc5b7ca96917400d8f061307778578e67a10e25852/orjson-3.11.9-cp313-cp313-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:8aff7da9952a5ad1cef8e68017724d96c7b9a66e99e91d6252e1b133d67a7b10", size = 135217, upload-time = "2026-05-06T15:10:26.084Z" }, + { url = "https://files.pythonhosted.org/packages/d5/97/1e3dc2b2a28b7b2528f403d2fc1d79ec5f39af3bc143ab65d3ec26426385/orjson-3.11.9-cp313-cp313-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:4d4e98d6f3b8afed8bc8cd9718ec0cdf46661826beefb53fe8eafb37f2bf0362", size = 145980, upload-time = "2026-05-06T15:10:28.062Z" }, + { url = "https://files.pythonhosted.org/packages/fc/39/31fbfe7850f2de32dee7e7e5c09f26d403ab01e440ac96001c6b01ad3c99/orjson-3.11.9-cp313-cp313-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:3a81d52442a7c99b3662333235b3adf96a1715864658b35bb797212be7bddb97", size = 132738, upload-time = "2026-05-06T15:10:29.727Z" }, + { url = "https://files.pythonhosted.org/packages/a1/08/dca0082dd2a194acb93e5457e73455388e2e2ca464a2672449a9ddbb679d/orjson-3.11.9-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:4e39364e726a8fff737309aff059ff67d8a8c8d5b677be7bb49a8b3e84b7e218", size = 134033, upload-time = "2026-05-06T15:10:31.152Z" }, + { url = "https://files.pythonhosted.org/packages/11/d4/5bdb0626801230139987385554c5d4c42255218ac906525bf4347f22cd95/orjson-3.11.9-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:4fd66214623f1b17501df9f0543bef0b833979ab5b6ded1e1d123222866aa8c9", size = 141492, upload-time = "2026-05-06T15:10:32.641Z" }, + { url = "https://files.pythonhosted.org/packages/fa/88/a21fb53b3ede6703aede6dce4710ed4111e5b201cfa6bbff5e544f9d47d7/orjson-3.11.9-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:8ecc30f10465fa1e0ce13fd01d9e22c316e5053a719a8d915d4545a09a5ff677", size = 415087, upload-time = "2026-05-06T15:10:34.438Z" }, + { url = "https://files.pythonhosted.org/packages/3d/57/1b30daf70f0d8180e9a73cefbfbdd99e4bf19eb020466502b01fba7e0e50/orjson-3.11.9-cp313-cp313-musllinux_1_2_i686.whl", hash = "sha256:97db4c94a7db398a5bd636273324f0b3fd58b350bbbac8bb380ceb825a9b40f4", size = 148031, upload-time = "2026-05-06T15:10:36.358Z" }, + { url = "https://files.pythonhosted.org/packages/04/83/45fbb6d962e260807f99441db9613cee868ceda4baceda59b3720a563f97/orjson-3.11.9-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:9f78cf8fec5bd627f4082b8dfeac7871b43d7f3274904492a43dab39f18a19a0", size = 136915, upload-time = "2026-05-06T15:10:38.013Z" }, + { url = "https://files.pythonhosted.org/packages/5f/cc/2d10025f9056d376e4127ec05a5808b218d46f035fdc08178a5411b34250/orjson-3.11.9-cp313-cp313-win32.whl", hash = "sha256:d4087e5c0209a0a8efe4de3303c234b9c44d1174161dcd851e8eea07c7560b32", size = 131613, upload-time = "2026-05-06T15:10:39.569Z" }, + { url = "https://files.pythonhosted.org/packages/67/bd/2775ff28bfe883b9aa1ff348300542eb2ef1ee18d8ae0e3a49846817a865/orjson-3.11.9-cp313-cp313-win_amd64.whl", hash = "sha256:051b102c93b4f634e89f3866b07b9a9a98915ada541f4ec30f177067b2694979", size = 127086, upload-time = "2026-05-06T15:10:41.262Z" }, + { url = "https://files.pythonhosted.org/packages/91/2b/d26799e580939e32a7da9a39531bc9e58e15ca32ffaa6a8cb3e9bb0d22cd/orjson-3.11.9-cp313-cp313-win_arm64.whl", hash = "sha256:cce9127885941bd28f080cecf1f1d288336b7e0d812c345b08be88b572796254", size = 126696, upload-time = "2026-05-06T15:10:42.651Z" }, + { url = "https://files.pythonhosted.org/packages/8e/eb/5da01e356015aee6ecfa1187ced87aef51364e306f5e695dd52719bf0e78/orjson-3.11.9-cp314-cp314-macosx_10_15_x86_64.macosx_11_0_arm64.macosx_10_15_universal2.whl", hash = "sha256:b6ef1979adc4bc243523f1a2ba91418030a8e29b0a99cbe7e0e2d6807d4dce6e", size = 228465, upload-time = "2026-05-06T15:10:44.097Z" }, + { url = "https://files.pythonhosted.org/packages/64/62/3e0e0c14c957133bcd855395c62b55ed4e3b0af23ffea11b032cb1dcbdb1/orjson-3.11.9-cp314-cp314-macosx_15_0_arm64.whl", hash = "sha256:f36b7f32c7c0db4a719f1fc5824db4a9c6f8bd1a354debb91faf26ebf3a4c71e", size = 128364, upload-time = "2026-05-06T15:10:45.839Z" }, + { url = "https://files.pythonhosted.org/packages/5a/5a/07d8aa117211a8ed7630bda80c8c0b14d04e0f8dcf99bcf49656e4a710eb/orjson-3.11.9-cp314-cp314-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:08f4d8ebb44925c794e535b2bebc507cebf32209df81de22ae285fb0d8d66de0", size = 132063, upload-time = "2026-05-06T15:10:47.267Z" }, + { url = "https://files.pythonhosted.org/packages/d6/ec/4acaf21483e18aa945be74a474c74b434f284b549f275a0a39b9f98956e9/orjson-3.11.9-cp314-cp314-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:6cc7923789694fd58f001cbcac7e47abc13af4d560ebbfcf3b41a8b1a0748124", size = 122356, upload-time = "2026-05-06T15:10:48.765Z" }, + { url = "https://files.pythonhosted.org/packages/13/d8/5f0555e7638801323b7a75850f92e7dfa891bc84fe27a1ba4449170d1200/orjson-3.11.9-cp314-cp314-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:ea5c46eb2d3af39e806b986f4b09d5c2706a1f5afde3cbf7544ce6616127173c", size = 129592, upload-time = "2026-05-06T15:10:50.13Z" }, + { url = "https://files.pythonhosted.org/packages/b6/30/ed9860412a3603ceb3c5955bfd72d28b9d0e7ba6ed81add14f83d7114236/orjson-3.11.9-cp314-cp314-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:f5d89a2ed90731df3be64bab0aa44f78bff39fdc9d71c291f4a8023aa46425b7", size = 140491, upload-time = "2026-05-06T15:10:51.582Z" }, + { url = "https://files.pythonhosted.org/packages/d0/17/adc514dea7ac7c505527febf884934b815d34f0c7b8693c1a8b39c5c4a57/orjson-3.11.9-cp314-cp314-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:25e4aed0312d292c09f61af25bba34e0b2c88546041472b09088c39a4d828af1", size = 127309, upload-time = "2026-05-06T15:10:53.329Z" }, + { url = "https://files.pythonhosted.org/packages/76/3e/c0b690253f0b82d86e99949af13533363acfb5432ecb5d53dd5b3bce9c34/orjson-3.11.9-cp314-cp314-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:aaea64f3f467d22e70eeed68bdccb3bc4f83f650446c4a03c59f2cba28a108db", size = 134030, upload-time = "2026-05-06T15:10:54.988Z" }, + { url = "https://files.pythonhosted.org/packages/c1/7a/bc82a0bb25e9faaf92dc4d9ef002732efc09737706af83e346788641d4a7/orjson-3.11.9-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:a028425d1b440c5d92a6be1e1a020739dfe67ea87d96c6dbe828c1b30041728b", size = 141482, upload-time = "2026-05-06T15:10:56.663Z" }, + { url = "https://files.pythonhosted.org/packages/01/55/e69188b939f77d5d32a9833745ace31ea5ccae3ab613a1ec185d3cd2c4fb/orjson-3.11.9-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:5b192c6cf397e4455b11523c5cf2b18ed084c1bbd61b6c0926344d2129481972", size = 415178, upload-time = "2026-05-06T15:10:58.446Z" }, + { url = "https://files.pythonhosted.org/packages/2e/1a/b8a5a7ac527e80b9cb11d51e3f6689b709279183264b9ec5c7bc680bb8b5/orjson-3.11.9-cp314-cp314-musllinux_1_2_i686.whl", hash = "sha256:ea407d4ccf5891d667d045fecae97a7a1e5e87b3b97f97ae1803c2e741130be0", size = 148089, upload-time = "2026-05-06T15:11:00.441Z" }, + { url = "https://files.pythonhosted.org/packages/97/4e/00503f64204bf859b37213a63927028f30fb6268cd8677fb0a5ad48155e1/orjson-3.11.9-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:5f63aaf97afd9f6dec5b1a68e1b8da12bfccb4cb9a9a65c3e0b6c847849e7586", size = 136921, upload-time = "2026-05-06T15:11:02.176Z" }, + { url = "https://files.pythonhosted.org/packages/0d/ba/a23b82a0a8d0ed7bed4e5f5035aae751cad4ff6a1e8d2ecd14d8860f5929/orjson-3.11.9-cp314-cp314-win32.whl", hash = "sha256:e30ab17845bb9fa54ccf67fa4f9f5282652d54faa6d17452f47d0f369d038673", size = 131638, upload-time = "2026-05-06T15:11:03.696Z" }, + { url = "https://files.pythonhosted.org/packages/f3/c3/0c6798456bade745c75c452342dabacce5798196483e77e643be1f53877d/orjson-3.11.9-cp314-cp314-win_amd64.whl", hash = "sha256:32ef5f4283a3be81913947d19608eacb7c6608026851123790cd9cc8982af34b", size = 127078, upload-time = "2026-05-06T15:11:05.123Z" }, + { url = "https://files.pythonhosted.org/packages/16/21/5a3f1e8913103b703a436a5664238e5b965ec392b555fe68943ea3691e6b/orjson-3.11.9-cp314-cp314-win_arm64.whl", hash = "sha256:eebdbdeef0094e4f5aefa20dcd4eb2368ab5e7a3b4edea27f1e7b2892e009cf9", size = 126687, upload-time = "2026-05-06T15:11:06.602Z" }, +] + +[[package]] +name = "packaging" +version = "26.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/65/ee/299d360cdc32edc7d2cf530f3accf79c4fca01e96ffc950d8a52213bd8e4/packaging-26.0.tar.gz", hash = "sha256:00243ae351a257117b6a241061796684b084ed1c516a08c48a3f7e147a9d80b4", size = 143416, upload-time = "2026-01-21T20:50:39.064Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b7/b9/c538f279a4e237a006a2c98387d081e9eb060d203d8ed34467cc0f0b9b53/packaging-26.0-py3-none-any.whl", hash = "sha256:b36f1fef9334a5588b4166f8bcd26a14e521f2b55e6b9de3aaa80d3ff7a37529", size = 74366, upload-time = "2026-01-21T20:50:37.788Z" }, +] + +[[package]] +name = "pandas" +version = "2.3.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, + { name = "python-dateutil" }, + { name = "pytz" }, + { name = "tzdata" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/33/01/d40b85317f86cf08d853a4f495195c73815fdf205eef3993821720274518/pandas-2.3.3.tar.gz", hash = "sha256:e05e1af93b977f7eafa636d043f9f94c7ee3ac81af99c13508215942e64c993b", size = 4495223, upload-time = "2025-09-29T23:34:51.853Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c1/fa/7ac648108144a095b4fb6aa3de1954689f7af60a14cf25583f4960ecb878/pandas-2.3.3-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:602b8615ebcc4a0c1751e71840428ddebeb142ec02c786e8ad6b1ce3c8dec523", size = 11578790, upload-time = "2025-09-29T23:18:30.065Z" }, + { url = "https://files.pythonhosted.org/packages/9b/35/74442388c6cf008882d4d4bdfc4109be87e9b8b7ccd097ad1e7f006e2e95/pandas-2.3.3-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:8fe25fc7b623b0ef6b5009149627e34d2a4657e880948ec3c840e9402e5c1b45", size = 10833831, upload-time = "2025-09-29T23:38:56.071Z" }, + { url = "https://files.pythonhosted.org/packages/fe/e4/de154cbfeee13383ad58d23017da99390b91d73f8c11856f2095e813201b/pandas-2.3.3-cp311-cp311-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b468d3dad6ff947df92dcb32ede5b7bd41a9b3cceef0a30ed925f6d01fb8fa66", size = 12199267, upload-time = "2025-09-29T23:18:41.627Z" }, + { url = "https://files.pythonhosted.org/packages/bf/c9/63f8d545568d9ab91476b1818b4741f521646cbdd151c6efebf40d6de6f7/pandas-2.3.3-cp311-cp311-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b98560e98cb334799c0b07ca7967ac361a47326e9b4e5a7dfb5ab2b1c9d35a1b", size = 12789281, upload-time = "2025-09-29T23:18:56.834Z" }, + { url = "https://files.pythonhosted.org/packages/f2/00/a5ac8c7a0e67fd1a6059e40aa08fa1c52cc00709077d2300e210c3ce0322/pandas-2.3.3-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:1d37b5848ba49824e5c30bedb9c830ab9b7751fd049bc7914533e01c65f79791", size = 13240453, upload-time = "2025-09-29T23:19:09.247Z" }, + { url = "https://files.pythonhosted.org/packages/27/4d/5c23a5bc7bd209231618dd9e606ce076272c9bc4f12023a70e03a86b4067/pandas-2.3.3-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:db4301b2d1f926ae677a751eb2bd0e8c5f5319c9cb3f88b0becbbb0b07b34151", size = 13890361, upload-time = "2025-09-29T23:19:25.342Z" }, + { url = "https://files.pythonhosted.org/packages/8e/59/712db1d7040520de7a4965df15b774348980e6df45c129b8c64d0dbe74ef/pandas-2.3.3-cp311-cp311-win_amd64.whl", hash = "sha256:f086f6fe114e19d92014a1966f43a3e62285109afe874f067f5abbdcbb10e59c", size = 11348702, upload-time = "2025-09-29T23:19:38.296Z" }, + { url = "https://files.pythonhosted.org/packages/9c/fb/231d89e8637c808b997d172b18e9d4a4bc7bf31296196c260526055d1ea0/pandas-2.3.3-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:6d21f6d74eb1725c2efaa71a2bfc661a0689579b58e9c0ca58a739ff0b002b53", size = 11597846, upload-time = "2025-09-29T23:19:48.856Z" }, + { url = "https://files.pythonhosted.org/packages/5c/bd/bf8064d9cfa214294356c2d6702b716d3cf3bb24be59287a6a21e24cae6b/pandas-2.3.3-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:3fd2f887589c7aa868e02632612ba39acb0b8948faf5cc58f0850e165bd46f35", size = 10729618, upload-time = "2025-09-29T23:39:08.659Z" }, + { url = "https://files.pythonhosted.org/packages/57/56/cf2dbe1a3f5271370669475ead12ce77c61726ffd19a35546e31aa8edf4e/pandas-2.3.3-cp312-cp312-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ecaf1e12bdc03c86ad4a7ea848d66c685cb6851d807a26aa245ca3d2017a1908", size = 11737212, upload-time = "2025-09-29T23:19:59.765Z" }, + { url = "https://files.pythonhosted.org/packages/e5/63/cd7d615331b328e287d8233ba9fdf191a9c2d11b6af0c7a59cfcec23de68/pandas-2.3.3-cp312-cp312-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b3d11d2fda7eb164ef27ffc14b4fcab16a80e1ce67e9f57e19ec0afaf715ba89", size = 12362693, upload-time = "2025-09-29T23:20:14.098Z" }, + { url = "https://files.pythonhosted.org/packages/a6/de/8b1895b107277d52f2b42d3a6806e69cfef0d5cf1d0ba343470b9d8e0a04/pandas-2.3.3-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:a68e15f780eddf2b07d242e17a04aa187a7ee12b40b930bfdd78070556550e98", size = 12771002, upload-time = "2025-09-29T23:20:26.76Z" }, + { url = "https://files.pythonhosted.org/packages/87/21/84072af3187a677c5893b170ba2c8fbe450a6ff911234916da889b698220/pandas-2.3.3-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:371a4ab48e950033bcf52b6527eccb564f52dc826c02afd9a1bc0ab731bba084", size = 13450971, upload-time = "2025-09-29T23:20:41.344Z" }, + { url = "https://files.pythonhosted.org/packages/86/41/585a168330ff063014880a80d744219dbf1dd7a1c706e75ab3425a987384/pandas-2.3.3-cp312-cp312-win_amd64.whl", hash = "sha256:a16dcec078a01eeef8ee61bf64074b4e524a2a3f4b3be9326420cabe59c4778b", size = 10992722, upload-time = "2025-09-29T23:20:54.139Z" }, + { url = "https://files.pythonhosted.org/packages/cd/4b/18b035ee18f97c1040d94debd8f2e737000ad70ccc8f5513f4eefad75f4b/pandas-2.3.3-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:56851a737e3470de7fa88e6131f41281ed440d29a9268dcbf0002da5ac366713", size = 11544671, upload-time = "2025-09-29T23:21:05.024Z" }, + { url = "https://files.pythonhosted.org/packages/31/94/72fac03573102779920099bcac1c3b05975c2cb5f01eac609faf34bed1ca/pandas-2.3.3-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:bdcd9d1167f4885211e401b3036c0c8d9e274eee67ea8d0758a256d60704cfe8", size = 10680807, upload-time = "2025-09-29T23:21:15.979Z" }, + { url = "https://files.pythonhosted.org/packages/16/87/9472cf4a487d848476865321de18cc8c920b8cab98453ab79dbbc98db63a/pandas-2.3.3-cp313-cp313-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e32e7cc9af0f1cc15548288a51a3b681cc2a219faa838e995f7dc53dbab1062d", size = 11709872, upload-time = "2025-09-29T23:21:27.165Z" }, + { url = "https://files.pythonhosted.org/packages/15/07/284f757f63f8a8d69ed4472bfd85122bd086e637bf4ed09de572d575a693/pandas-2.3.3-cp313-cp313-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:318d77e0e42a628c04dc56bcef4b40de67918f7041c2b061af1da41dcff670ac", size = 12306371, upload-time = "2025-09-29T23:21:40.532Z" }, + { url = "https://files.pythonhosted.org/packages/33/81/a3afc88fca4aa925804a27d2676d22dcd2031c2ebe08aabd0ae55b9ff282/pandas-2.3.3-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:4e0a175408804d566144e170d0476b15d78458795bb18f1304fb94160cabf40c", size = 12765333, upload-time = "2025-09-29T23:21:55.77Z" }, + { url = "https://files.pythonhosted.org/packages/8d/0f/b4d4ae743a83742f1153464cf1a8ecfafc3ac59722a0b5c8602310cb7158/pandas-2.3.3-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:93c2d9ab0fc11822b5eece72ec9587e172f63cff87c00b062f6e37448ced4493", size = 13418120, upload-time = "2025-09-29T23:22:10.109Z" }, + { url = "https://files.pythonhosted.org/packages/4f/c7/e54682c96a895d0c808453269e0b5928a07a127a15704fedb643e9b0a4c8/pandas-2.3.3-cp313-cp313-win_amd64.whl", hash = "sha256:f8bfc0e12dc78f777f323f55c58649591b2cd0c43534e8355c51d3fede5f4dee", size = 10993991, upload-time = "2025-09-29T23:25:04.889Z" }, + { url = "https://files.pythonhosted.org/packages/f9/ca/3f8d4f49740799189e1395812f3bf23b5e8fc7c190827d55a610da72ce55/pandas-2.3.3-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:75ea25f9529fdec2d2e93a42c523962261e567d250b0013b16210e1d40d7c2e5", size = 12048227, upload-time = "2025-09-29T23:22:24.343Z" }, + { url = "https://files.pythonhosted.org/packages/0e/5a/f43efec3e8c0cc92c4663ccad372dbdff72b60bdb56b2749f04aa1d07d7e/pandas-2.3.3-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:74ecdf1d301e812db96a465a525952f4dde225fdb6d8e5a521d47e1f42041e21", size = 11411056, upload-time = "2025-09-29T23:22:37.762Z" }, + { url = "https://files.pythonhosted.org/packages/46/b1/85331edfc591208c9d1a63a06baa67b21d332e63b7a591a5ba42a10bb507/pandas-2.3.3-cp313-cp313t-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6435cb949cb34ec11cc9860246ccb2fdc9ecd742c12d3304989017d53f039a78", size = 11645189, upload-time = "2025-09-29T23:22:51.688Z" }, + { url = "https://files.pythonhosted.org/packages/44/23/78d645adc35d94d1ac4f2a3c4112ab6f5b8999f4898b8cdf01252f8df4a9/pandas-2.3.3-cp313-cp313t-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:900f47d8f20860de523a1ac881c4c36d65efcb2eb850e6948140fa781736e110", size = 12121912, upload-time = "2025-09-29T23:23:05.042Z" }, + { url = "https://files.pythonhosted.org/packages/53/da/d10013df5e6aaef6b425aa0c32e1fc1f3e431e4bcabd420517dceadce354/pandas-2.3.3-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:a45c765238e2ed7d7c608fc5bc4a6f88b642f2f01e70c0c23d2224dd21829d86", size = 12712160, upload-time = "2025-09-29T23:23:28.57Z" }, + { url = "https://files.pythonhosted.org/packages/bd/17/e756653095a083d8a37cbd816cb87148debcfcd920129b25f99dd8d04271/pandas-2.3.3-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:c4fc4c21971a1a9f4bdb4c73978c7f7256caa3e62b323f70d6cb80db583350bc", size = 13199233, upload-time = "2025-09-29T23:24:24.876Z" }, + { url = "https://files.pythonhosted.org/packages/04/fd/74903979833db8390b73b3a8a7d30d146d710bd32703724dd9083950386f/pandas-2.3.3-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:ee15f284898e7b246df8087fc82b87b01686f98ee67d85a17b7ab44143a3a9a0", size = 11540635, upload-time = "2025-09-29T23:25:52.486Z" }, + { url = "https://files.pythonhosted.org/packages/21/00/266d6b357ad5e6d3ad55093a7e8efc7dd245f5a842b584db9f30b0f0a287/pandas-2.3.3-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:1611aedd912e1ff81ff41c745822980c49ce4a7907537be8692c8dbc31924593", size = 10759079, upload-time = "2025-09-29T23:26:33.204Z" }, + { url = "https://files.pythonhosted.org/packages/ca/05/d01ef80a7a3a12b2f8bbf16daba1e17c98a2f039cbc8e2f77a2c5a63d382/pandas-2.3.3-cp314-cp314-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6d2cefc361461662ac48810cb14365a365ce864afe85ef1f447ff5a1e99ea81c", size = 11814049, upload-time = "2025-09-29T23:27:15.384Z" }, + { url = "https://files.pythonhosted.org/packages/15/b2/0e62f78c0c5ba7e3d2c5945a82456f4fac76c480940f805e0b97fcbc2f65/pandas-2.3.3-cp314-cp314-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ee67acbbf05014ea6c763beb097e03cd629961c8a632075eeb34247120abcb4b", size = 12332638, upload-time = "2025-09-29T23:27:51.625Z" }, + { url = "https://files.pythonhosted.org/packages/c5/33/dd70400631b62b9b29c3c93d2feee1d0964dc2bae2e5ad7a6c73a7f25325/pandas-2.3.3-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:c46467899aaa4da076d5abc11084634e2d197e9460643dd455ac3db5856b24d6", size = 12886834, upload-time = "2025-09-29T23:28:21.289Z" }, + { url = "https://files.pythonhosted.org/packages/d3/18/b5d48f55821228d0d2692b34fd5034bb185e854bdb592e9c640f6290e012/pandas-2.3.3-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:6253c72c6a1d990a410bc7de641d34053364ef8bcd3126f7e7450125887dffe3", size = 13409925, upload-time = "2025-09-29T23:28:58.261Z" }, + { url = "https://files.pythonhosted.org/packages/a6/3d/124ac75fcd0ecc09b8fdccb0246ef65e35b012030defb0e0eba2cbbbe948/pandas-2.3.3-cp314-cp314-win_amd64.whl", hash = "sha256:1b07204a219b3b7350abaae088f451860223a52cfb8a6c53358e7948735158e5", size = 11109071, upload-time = "2025-09-29T23:32:27.484Z" }, + { url = "https://files.pythonhosted.org/packages/89/9c/0e21c895c38a157e0faa1fb64587a9226d6dd46452cac4532d80c3c4a244/pandas-2.3.3-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:2462b1a365b6109d275250baaae7b760fd25c726aaca0054649286bcfbb3e8ec", size = 12048504, upload-time = "2025-09-29T23:29:31.47Z" }, + { url = "https://files.pythonhosted.org/packages/d7/82/b69a1c95df796858777b68fbe6a81d37443a33319761d7c652ce77797475/pandas-2.3.3-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:0242fe9a49aa8b4d78a4fa03acb397a58833ef6199e9aa40a95f027bb3a1b6e7", size = 11410702, upload-time = "2025-09-29T23:29:54.591Z" }, + { url = "https://files.pythonhosted.org/packages/f9/88/702bde3ba0a94b8c73a0181e05144b10f13f29ebfc2150c3a79062a8195d/pandas-2.3.3-cp314-cp314t-manylinux_2_24_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a21d830e78df0a515db2b3d2f5570610f5e6bd2e27749770e8bb7b524b89b450", size = 11634535, upload-time = "2025-09-29T23:30:21.003Z" }, + { url = "https://files.pythonhosted.org/packages/a4/1e/1bac1a839d12e6a82ec6cb40cda2edde64a2013a66963293696bbf31fbbb/pandas-2.3.3-cp314-cp314t-manylinux_2_24_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:2e3ebdb170b5ef78f19bfb71b0dc5dc58775032361fa188e814959b74d726dd5", size = 12121582, upload-time = "2025-09-29T23:30:43.391Z" }, + { url = "https://files.pythonhosted.org/packages/44/91/483de934193e12a3b1d6ae7c8645d083ff88dec75f46e827562f1e4b4da6/pandas-2.3.3-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:d051c0e065b94b7a3cea50eb1ec32e912cd96dba41647eb24104b6c6c14c5788", size = 12699963, upload-time = "2025-09-29T23:31:10.009Z" }, + { url = "https://files.pythonhosted.org/packages/70/44/5191d2e4026f86a2a109053e194d3ba7a31a2d10a9c2348368c63ed4e85a/pandas-2.3.3-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:3869faf4bd07b3b66a9f462417d0ca3a9df29a9f6abd5d0d0dbab15dac7abe87", size = 13202175, upload-time = "2025-09-29T23:31:59.173Z" }, +] + +[[package]] +name = "parso" +version = "0.8.6" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/81/76/a1e769043c0c0c9fe391b702539d594731a4362334cdf4dc25d0c09761e7/parso-0.8.6.tar.gz", hash = "sha256:2b9a0332696df97d454fa67b81618fd69c35a7b90327cbe6ba5c92d2c68a7bfd", size = 401621, upload-time = "2026-02-09T15:45:24.425Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b6/61/fae042894f4296ec49e3f193aff5d7c18440da9e48102c3315e1bc4519a7/parso-0.8.6-py2.py3-none-any.whl", hash = "sha256:2c549f800b70a5c4952197248825584cb00f033b29c692671d3bf08bf380baff", size = 106894, upload-time = "2026-02-09T15:45:21.391Z" }, +] + +[[package]] +name = "pefile" +version = "2024.8.26" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/03/4f/2750f7f6f025a1507cd3b7218691671eecfd0bbebebe8b39aa0fe1d360b8/pefile-2024.8.26.tar.gz", hash = "sha256:3ff6c5d8b43e8c37bb6e6dd5085658d658a7a0bdcd20b6a07b1fcfc1c4e9d632", size = 76008, upload-time = "2024-08-26T20:58:38.155Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/54/16/12b82f791c7f50ddec566873d5bdd245baa1491bac11d15ffb98aecc8f8b/pefile-2024.8.26-py3-none-any.whl", hash = "sha256:76f8b485dcd3b1bb8166f1128d395fa3d87af26360c2358fb75b80019b957c6f", size = 74766, upload-time = "2024-08-26T21:01:02.632Z" }, +] + +[[package]] +name = "pexpect" +version = "4.9.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "ptyprocess", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/42/92/cc564bf6381ff43ce1f4d06852fc19a2f11d180f23dc32d9588bee2f149d/pexpect-4.9.0.tar.gz", hash = "sha256:ee7d41123f3c9911050ea2c2dac107568dc43b2d3b0c7557a33212c398ead30f", size = 166450, upload-time = "2023-11-25T09:07:26.339Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/9e/c3/059298687310d527a58bb01f3b1965787ee3b40dce76752eda8b44e9a2c5/pexpect-4.9.0-py2.py3-none-any.whl", hash = "sha256:7236d1e080e4936be2dc3e326cec0af72acf9212a7e1d060210e70a47e253523", size = 63772, upload-time = "2023-11-25T06:56:14.81Z" }, +] + +[[package]] +name = "pillow" +version = "12.1.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/1f/42/5c74462b4fd957fcd7b13b04fb3205ff8349236ea74c7c375766d6c82288/pillow-12.1.1.tar.gz", hash = "sha256:9ad8fa5937ab05218e2b6a4cff30295ad35afd2f83ac592e68c0d871bb0fdbc4", size = 46980264, upload-time = "2026-02-11T04:23:07.146Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/2b/46/5da1ec4a5171ee7bf1a0efa064aba70ba3d6e0788ce3f5acd1375d23c8c0/pillow-12.1.1-cp311-cp311-macosx_10_10_x86_64.whl", hash = "sha256:e879bb6cd5c73848ef3b2b48b8af9ff08c5b71ecda8048b7dd22d8a33f60be32", size = 5304084, upload-time = "2026-02-11T04:20:27.501Z" }, + { url = "https://files.pythonhosted.org/packages/78/93/a29e9bc02d1cf557a834da780ceccd54e02421627200696fcf805ebdc3fb/pillow-12.1.1-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:365b10bb9417dd4498c0e3b128018c4a624dc11c7b97d8cc54effe3b096f4c38", size = 4657866, upload-time = "2026-02-11T04:20:29.827Z" }, + { url = "https://files.pythonhosted.org/packages/13/84/583a4558d492a179d31e4aae32eadce94b9acf49c0337c4ce0b70e0a01f2/pillow-12.1.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:d4ce8e329c93845720cd2014659ca67eac35f6433fd3050393d85f3ecef0dad5", size = 6232148, upload-time = "2026-02-11T04:20:31.329Z" }, + { url = "https://files.pythonhosted.org/packages/d5/e2/53c43334bbbb2d3b938978532fbda8e62bb6e0b23a26ce8592f36bcc4987/pillow-12.1.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:fc354a04072b765eccf2204f588a7a532c9511e8b9c7f900e1b64e3e33487090", size = 8038007, upload-time = "2026-02-11T04:20:34.225Z" }, + { url = "https://files.pythonhosted.org/packages/b8/a6/3d0e79c8a9d58150dd98e199d7c1c56861027f3829a3a60b3c2784190180/pillow-12.1.1-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:7e7976bf1910a8116b523b9f9f58bf410f3e8aa330cd9a2bb2953f9266ab49af", size = 6345418, upload-time = "2026-02-11T04:20:35.858Z" }, + { url = "https://files.pythonhosted.org/packages/a2/c8/46dfeac5825e600579157eea177be43e2f7ff4a99da9d0d0a49533509ac5/pillow-12.1.1-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:597bd9c8419bc7c6af5604e55847789b69123bbe25d65cc6ad3012b4f3c98d8b", size = 7034590, upload-time = "2026-02-11T04:20:37.91Z" }, + { url = "https://files.pythonhosted.org/packages/af/bf/e6f65d3db8a8bbfeaf9e13cc0417813f6319863a73de934f14b2229ada18/pillow-12.1.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:2c1fc0f2ca5f96a3c8407e41cca26a16e46b21060fe6d5b099d2cb01412222f5", size = 6458655, upload-time = "2026-02-11T04:20:39.496Z" }, + { url = "https://files.pythonhosted.org/packages/f9/c2/66091f3f34a25894ca129362e510b956ef26f8fb67a0e6417bc5744e56f1/pillow-12.1.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:578510d88c6229d735855e1f278aa305270438d36a05031dfaae5067cc8eb04d", size = 7159286, upload-time = "2026-02-11T04:20:41.139Z" }, + { url = "https://files.pythonhosted.org/packages/7b/5a/24bc8eb526a22f957d0cec6243146744966d40857e3d8deb68f7902ca6c1/pillow-12.1.1-cp311-cp311-win32.whl", hash = "sha256:7311c0a0dcadb89b36b7025dfd8326ecfa36964e29913074d47382706e516a7c", size = 6328663, upload-time = "2026-02-11T04:20:43.184Z" }, + { url = "https://files.pythonhosted.org/packages/31/03/bef822e4f2d8f9d7448c133d0a18185d3cce3e70472774fffefe8b0ed562/pillow-12.1.1-cp311-cp311-win_amd64.whl", hash = "sha256:fbfa2a7c10cc2623f412753cddf391c7f971c52ca40a3f65dc5039b2939e8563", size = 7031448, upload-time = "2026-02-11T04:20:44.696Z" }, + { url = "https://files.pythonhosted.org/packages/49/70/f76296f53610bd17b2e7d31728b8b7825e3ac3b5b3688b51f52eab7c0818/pillow-12.1.1-cp311-cp311-win_arm64.whl", hash = "sha256:b81b5e3511211631b3f672a595e3221252c90af017e399056d0faabb9538aa80", size = 2453651, upload-time = "2026-02-11T04:20:46.243Z" }, + { url = "https://files.pythonhosted.org/packages/07/d3/8df65da0d4df36b094351dce696f2989bec731d4f10e743b1c5f4da4d3bf/pillow-12.1.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:ab323b787d6e18b3d91a72fc99b1a2c28651e4358749842b8f8dfacd28ef2052", size = 5262803, upload-time = "2026-02-11T04:20:47.653Z" }, + { url = "https://files.pythonhosted.org/packages/d6/71/5026395b290ff404b836e636f51d7297e6c83beceaa87c592718747e670f/pillow-12.1.1-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:adebb5bee0f0af4909c30db0d890c773d1a92ffe83da908e2e9e720f8edf3984", size = 4657601, upload-time = "2026-02-11T04:20:49.328Z" }, + { url = "https://files.pythonhosted.org/packages/b1/2e/1001613d941c67442f745aff0f7cc66dd8df9a9c084eb497e6a543ee6f7e/pillow-12.1.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:bb66b7cc26f50977108790e2456b7921e773f23db5630261102233eb355a3b79", size = 6234995, upload-time = "2026-02-11T04:20:51.032Z" }, + { url = "https://files.pythonhosted.org/packages/07/26/246ab11455b2549b9233dbd44d358d033a2f780fa9007b61a913c5b2d24e/pillow-12.1.1-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:aee2810642b2898bb187ced9b349e95d2a7272930796e022efaf12e99dccd293", size = 8045012, upload-time = "2026-02-11T04:20:52.882Z" }, + { url = "https://files.pythonhosted.org/packages/b2/8b/07587069c27be7535ac1fe33874e32de118fbd34e2a73b7f83436a88368c/pillow-12.1.1-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a0b1cd6232e2b618adcc54d9882e4e662a089d5768cd188f7c245b4c8c44a397", size = 6349638, upload-time = "2026-02-11T04:20:54.444Z" }, + { url = "https://files.pythonhosted.org/packages/ff/79/6df7b2ee763d619cda2fb4fea498e5f79d984dae304d45a8999b80d6cf5c/pillow-12.1.1-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:7aac39bcf8d4770d089588a2e1dd111cbaa42df5a94be3114222057d68336bd0", size = 7041540, upload-time = "2026-02-11T04:20:55.97Z" }, + { url = "https://files.pythonhosted.org/packages/2c/5e/2ba19e7e7236d7529f4d873bdaf317a318896bac289abebd4bb00ef247f0/pillow-12.1.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:ab174cd7d29a62dd139c44bf74b698039328f45cb03b4596c43473a46656b2f3", size = 6462613, upload-time = "2026-02-11T04:20:57.542Z" }, + { url = "https://files.pythonhosted.org/packages/03/03/31216ec124bb5c3dacd74ce8efff4cc7f52643653bad4825f8f08c697743/pillow-12.1.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:339ffdcb7cbeaa08221cd401d517d4b1fe7a9ed5d400e4a8039719238620ca35", size = 7166745, upload-time = "2026-02-11T04:20:59.196Z" }, + { url = "https://files.pythonhosted.org/packages/1f/e7/7c4552d80052337eb28653b617eafdef39adfb137c49dd7e831b8dc13bc5/pillow-12.1.1-cp312-cp312-win32.whl", hash = "sha256:5d1f9575a12bed9e9eedd9a4972834b08c97a352bd17955ccdebfeca5913fa0a", size = 6328823, upload-time = "2026-02-11T04:21:01.385Z" }, + { url = "https://files.pythonhosted.org/packages/3d/17/688626d192d7261bbbf98846fc98995726bddc2c945344b65bec3a29d731/pillow-12.1.1-cp312-cp312-win_amd64.whl", hash = "sha256:21329ec8c96c6e979cd0dfd29406c40c1d52521a90544463057d2aaa937d66a6", size = 7033367, upload-time = "2026-02-11T04:21:03.536Z" }, + { url = "https://files.pythonhosted.org/packages/ed/fe/a0ef1f73f939b0eca03ee2c108d0043a87468664770612602c63266a43c4/pillow-12.1.1-cp312-cp312-win_arm64.whl", hash = "sha256:af9a332e572978f0218686636610555ae3defd1633597be015ed50289a03c523", size = 2453811, upload-time = "2026-02-11T04:21:05.116Z" }, + { url = "https://files.pythonhosted.org/packages/d5/11/6db24d4bd7685583caeae54b7009584e38da3c3d4488ed4cd25b439de486/pillow-12.1.1-cp313-cp313-ios_13_0_arm64_iphoneos.whl", hash = "sha256:d242e8ac078781f1de88bf823d70c1a9b3c7950a44cdf4b7c012e22ccbcd8e4e", size = 4062689, upload-time = "2026-02-11T04:21:06.804Z" }, + { url = "https://files.pythonhosted.org/packages/33/c0/ce6d3b1fe190f0021203e0d9b5b99e57843e345f15f9ef22fcd43842fd21/pillow-12.1.1-cp313-cp313-ios_13_0_arm64_iphonesimulator.whl", hash = "sha256:02f84dfad02693676692746df05b89cf25597560db2857363a208e393429f5e9", size = 4138535, upload-time = "2026-02-11T04:21:08.452Z" }, + { url = "https://files.pythonhosted.org/packages/a0/c6/d5eb6a4fb32a3f9c21a8c7613ec706534ea1cf9f4b3663e99f0d83f6fca8/pillow-12.1.1-cp313-cp313-ios_13_0_x86_64_iphonesimulator.whl", hash = "sha256:e65498daf4b583091ccbb2556c7000abf0f3349fcd57ef7adc9a84a394ed29f6", size = 3601364, upload-time = "2026-02-11T04:21:10.194Z" }, + { url = "https://files.pythonhosted.org/packages/14/a1/16c4b823838ba4c9c52c0e6bbda903a3fe5a1bdbf1b8eb4fff7156f3e318/pillow-12.1.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:6c6db3b84c87d48d0088943bf33440e0c42370b99b1c2a7989216f7b42eede60", size = 5262561, upload-time = "2026-02-11T04:21:11.742Z" }, + { url = "https://files.pythonhosted.org/packages/bb/ad/ad9dc98ff24f485008aa5cdedaf1a219876f6f6c42a4626c08bc4e80b120/pillow-12.1.1-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:8b7e5304e34942bf62e15184219a7b5ad4ff7f3bb5cca4d984f37df1a0e1aee2", size = 4657460, upload-time = "2026-02-11T04:21:13.786Z" }, + { url = "https://files.pythonhosted.org/packages/9e/1b/f1a4ea9a895b5732152789326202a82464d5254759fbacae4deea3069334/pillow-12.1.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:18e5bddd742a44b7e6b1e773ab5db102bd7a94c32555ba656e76d319d19c3850", size = 6232698, upload-time = "2026-02-11T04:21:15.949Z" }, + { url = "https://files.pythonhosted.org/packages/95/f4/86f51b8745070daf21fd2e5b1fe0eb35d4db9ca26e6d58366562fb56a743/pillow-12.1.1-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:fc44ef1f3de4f45b50ccf9136999d71abb99dca7706bc75d222ed350b9fd2289", size = 8041706, upload-time = "2026-02-11T04:21:17.723Z" }, + { url = "https://files.pythonhosted.org/packages/29/9b/d6ecd956bb1266dd1045e995cce9b8d77759e740953a1c9aad9502a0461e/pillow-12.1.1-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5a8eb7ed8d4198bccbd07058416eeec51686b498e784eda166395a23eb99138e", size = 6346621, upload-time = "2026-02-11T04:21:19.547Z" }, + { url = "https://files.pythonhosted.org/packages/71/24/538bff45bde96535d7d998c6fed1a751c75ac7c53c37c90dc2601b243893/pillow-12.1.1-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:47b94983da0c642de92ced1702c5b6c292a84bd3a8e1d1702ff923f183594717", size = 7038069, upload-time = "2026-02-11T04:21:21.378Z" }, + { url = "https://files.pythonhosted.org/packages/94/0e/58cb1a6bc48f746bc4cb3adb8cabff73e2742c92b3bf7a220b7cf69b9177/pillow-12.1.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:518a48c2aab7ce596d3bf79d0e275661b846e86e4d0e7dec34712c30fe07f02a", size = 6460040, upload-time = "2026-02-11T04:21:23.148Z" }, + { url = "https://files.pythonhosted.org/packages/6c/57/9045cb3ff11eeb6c1adce3b2d60d7d299d7b273a2e6c8381a524abfdc474/pillow-12.1.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:a550ae29b95c6dc13cf69e2c9dc5747f814c54eeb2e32d683e5e93af56caa029", size = 7164523, upload-time = "2026-02-11T04:21:25.01Z" }, + { url = "https://files.pythonhosted.org/packages/73/f2/9be9cb99f2175f0d4dbadd6616ce1bf068ee54a28277ea1bf1fbf729c250/pillow-12.1.1-cp313-cp313-win32.whl", hash = "sha256:a003d7422449f6d1e3a34e3dd4110c22148336918ddbfc6a32581cd54b2e0b2b", size = 6332552, upload-time = "2026-02-11T04:21:27.238Z" }, + { url = "https://files.pythonhosted.org/packages/3f/eb/b0834ad8b583d7d9d42b80becff092082a1c3c156bb582590fcc973f1c7c/pillow-12.1.1-cp313-cp313-win_amd64.whl", hash = "sha256:344cf1e3dab3be4b1fa08e449323d98a2a3f819ad20f4b22e77a0ede31f0faa1", size = 7040108, upload-time = "2026-02-11T04:21:29.462Z" }, + { url = "https://files.pythonhosted.org/packages/d5/7d/fc09634e2aabdd0feabaff4a32f4a7d97789223e7c2042fd805ea4b4d2c2/pillow-12.1.1-cp313-cp313-win_arm64.whl", hash = "sha256:5c0dd1636633e7e6a0afe7bf6a51a14992b7f8e60de5789018ebbdfae55b040a", size = 2453712, upload-time = "2026-02-11T04:21:31.072Z" }, + { url = "https://files.pythonhosted.org/packages/19/2a/b9d62794fc8a0dd14c1943df68347badbd5511103e0d04c035ffe5cf2255/pillow-12.1.1-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:0330d233c1a0ead844fc097a7d16c0abff4c12e856c0b325f231820fee1f39da", size = 5264880, upload-time = "2026-02-11T04:21:32.865Z" }, + { url = "https://files.pythonhosted.org/packages/26/9d/e03d857d1347fa5ed9247e123fcd2a97b6220e15e9cb73ca0a8d91702c6e/pillow-12.1.1-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:5dae5f21afb91322f2ff791895ddd8889e5e947ff59f71b46041c8ce6db790bc", size = 4660616, upload-time = "2026-02-11T04:21:34.97Z" }, + { url = "https://files.pythonhosted.org/packages/f7/ec/8a6d22afd02570d30954e043f09c32772bfe143ba9285e2fdb11284952cd/pillow-12.1.1-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:2e0c664be47252947d870ac0d327fea7e63985a08794758aa8af5b6cb6ec0c9c", size = 6269008, upload-time = "2026-02-11T04:21:36.623Z" }, + { url = "https://files.pythonhosted.org/packages/3d/1d/6d875422c9f28a4a361f495a5f68d9de4a66941dc2c619103ca335fa6446/pillow-12.1.1-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:691ab2ac363b8217f7d31b3497108fb1f50faab2f75dfb03284ec2f217e87bf8", size = 8073226, upload-time = "2026-02-11T04:21:38.585Z" }, + { url = "https://files.pythonhosted.org/packages/a1/cd/134b0b6ee5eda6dc09e25e24b40fdafe11a520bc725c1d0bbaa5e00bf95b/pillow-12.1.1-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e9e8064fb1cc019296958595f6db671fba95209e3ceb0c4734c9baf97de04b20", size = 6380136, upload-time = "2026-02-11T04:21:40.562Z" }, + { url = "https://files.pythonhosted.org/packages/7a/a9/7628f013f18f001c1b98d8fffe3452f306a70dc6aba7d931019e0492f45e/pillow-12.1.1-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:472a8d7ded663e6162dafdf20015c486a7009483ca671cece7a9279b512fcb13", size = 7067129, upload-time = "2026-02-11T04:21:42.521Z" }, + { url = "https://files.pythonhosted.org/packages/1e/f8/66ab30a2193b277785601e82ee2d49f68ea575d9637e5e234faaa98efa4c/pillow-12.1.1-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:89b54027a766529136a06cfebeecb3a04900397a3590fd252160b888479517bf", size = 6491807, upload-time = "2026-02-11T04:21:44.22Z" }, + { url = "https://files.pythonhosted.org/packages/da/0b/a877a6627dc8318fdb84e357c5e1a758c0941ab1ddffdafd231983788579/pillow-12.1.1-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:86172b0831b82ce4f7877f280055892b31179e1576aa00d0df3bb1bbf8c3e524", size = 7190954, upload-time = "2026-02-11T04:21:46.114Z" }, + { url = "https://files.pythonhosted.org/packages/83/43/6f732ff85743cf746b1361b91665d9f5155e1483817f693f8d57ea93147f/pillow-12.1.1-cp313-cp313t-win32.whl", hash = "sha256:44ce27545b6efcf0fdbdceb31c9a5bdea9333e664cda58a7e674bb74608b3986", size = 6336441, upload-time = "2026-02-11T04:21:48.22Z" }, + { url = "https://files.pythonhosted.org/packages/3b/44/e865ef3986611bb75bfabdf94a590016ea327833f434558801122979cd0e/pillow-12.1.1-cp313-cp313t-win_amd64.whl", hash = "sha256:a285e3eb7a5a45a2ff504e31f4a8d1b12ef62e84e5411c6804a42197c1cf586c", size = 7045383, upload-time = "2026-02-11T04:21:50.015Z" }, + { url = "https://files.pythonhosted.org/packages/a8/c6/f4fb24268d0c6908b9f04143697ea18b0379490cb74ba9e8d41b898bd005/pillow-12.1.1-cp313-cp313t-win_arm64.whl", hash = "sha256:cc7d296b5ea4d29e6570dabeaed58d31c3fea35a633a69679fb03d7664f43fb3", size = 2456104, upload-time = "2026-02-11T04:21:51.633Z" }, + { url = "https://files.pythonhosted.org/packages/03/d0/bebb3ffbf31c5a8e97241476c4cf8b9828954693ce6744b4a2326af3e16b/pillow-12.1.1-cp314-cp314-ios_13_0_arm64_iphoneos.whl", hash = "sha256:417423db963cb4be8bac3fc1204fe61610f6abeed1580a7a2cbb2fbda20f12af", size = 4062652, upload-time = "2026-02-11T04:21:53.19Z" }, + { url = "https://files.pythonhosted.org/packages/2d/c0/0e16fb0addda4851445c28f8350d8c512f09de27bbb0d6d0bbf8b6709605/pillow-12.1.1-cp314-cp314-ios_13_0_arm64_iphonesimulator.whl", hash = "sha256:b957b71c6b2387610f556a7eb0828afbe40b4a98036fc0d2acfa5a44a0c2036f", size = 4138823, upload-time = "2026-02-11T04:22:03.088Z" }, + { url = "https://files.pythonhosted.org/packages/6b/fb/6170ec655d6f6bb6630a013dd7cf7bc218423d7b5fa9071bf63dc32175ae/pillow-12.1.1-cp314-cp314-ios_13_0_x86_64_iphonesimulator.whl", hash = "sha256:097690ba1f2efdeb165a20469d59d8bb03c55fb6621eb2041a060ae8ea3e9642", size = 3601143, upload-time = "2026-02-11T04:22:04.909Z" }, + { url = "https://files.pythonhosted.org/packages/59/04/dc5c3f297510ba9a6837cbb318b87dd2b8f73eb41a43cc63767f65cb599c/pillow-12.1.1-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:2815a87ab27848db0321fb78c7f0b2c8649dee134b7f2b80c6a45c6831d75ccd", size = 5266254, upload-time = "2026-02-11T04:22:07.656Z" }, + { url = "https://files.pythonhosted.org/packages/05/30/5db1236b0d6313f03ebf97f5e17cda9ca060f524b2fcc875149a8360b21c/pillow-12.1.1-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:f7ed2c6543bad5a7d5530eb9e78c53132f93dfa44a28492db88b41cdab885202", size = 4657499, upload-time = "2026-02-11T04:22:09.613Z" }, + { url = "https://files.pythonhosted.org/packages/6f/18/008d2ca0eb612e81968e8be0bbae5051efba24d52debf930126d7eaacbba/pillow-12.1.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:652a2c9ccfb556235b2b501a3a7cf3742148cd22e04b5625c5fe057ea3e3191f", size = 6232137, upload-time = "2026-02-11T04:22:11.434Z" }, + { url = "https://files.pythonhosted.org/packages/70/f1/f14d5b8eeb4b2cd62b9f9f847eb6605f103df89ef619ac68f92f748614ea/pillow-12.1.1-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:d6e4571eedf43af33d0fc233a382a76e849badbccdf1ac438841308652a08e1f", size = 8042721, upload-time = "2026-02-11T04:22:13.321Z" }, + { url = "https://files.pythonhosted.org/packages/5a/d6/17824509146e4babbdabf04d8171491fa9d776f7061ff6e727522df9bd03/pillow-12.1.1-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b574c51cf7d5d62e9be37ba446224b59a2da26dc4c1bb2ecbe936a4fb1a7cb7f", size = 6347798, upload-time = "2026-02-11T04:22:15.449Z" }, + { url = "https://files.pythonhosted.org/packages/d1/ee/c85a38a9ab92037a75615aba572c85ea51e605265036e00c5b67dfafbfe2/pillow-12.1.1-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:a37691702ed687799de29a518d63d4682d9016932db66d4e90c345831b02fb4e", size = 7039315, upload-time = "2026-02-11T04:22:17.24Z" }, + { url = "https://files.pythonhosted.org/packages/ec/f3/bc8ccc6e08a148290d7523bde4d9a0d6c981db34631390dc6e6ec34cacf6/pillow-12.1.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:f95c00d5d6700b2b890479664a06e754974848afaae5e21beb4d83c106923fd0", size = 6462360, upload-time = "2026-02-11T04:22:19.111Z" }, + { url = "https://files.pythonhosted.org/packages/f6/ab/69a42656adb1d0665ab051eec58a41f169ad295cf81ad45406963105408f/pillow-12.1.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:559b38da23606e68681337ad74622c4dbba02254fc9cb4488a305dd5975c7eeb", size = 7165438, upload-time = "2026-02-11T04:22:21.041Z" }, + { url = "https://files.pythonhosted.org/packages/02/46/81f7aa8941873f0f01d4b55cc543b0a3d03ec2ee30d617a0448bf6bd6dec/pillow-12.1.1-cp314-cp314-win32.whl", hash = "sha256:03edcc34d688572014ff223c125a3f77fb08091e4607e7745002fc214070b35f", size = 6431503, upload-time = "2026-02-11T04:22:22.833Z" }, + { url = "https://files.pythonhosted.org/packages/40/72/4c245f7d1044b67affc7f134a09ea619d4895333d35322b775b928180044/pillow-12.1.1-cp314-cp314-win_amd64.whl", hash = "sha256:50480dcd74fa63b8e78235957d302d98d98d82ccbfac4c7e12108ba9ecbdba15", size = 7176748, upload-time = "2026-02-11T04:22:24.64Z" }, + { url = "https://files.pythonhosted.org/packages/e4/ad/8a87bdbe038c5c698736e3348af5c2194ffb872ea52f11894c95f9305435/pillow-12.1.1-cp314-cp314-win_arm64.whl", hash = "sha256:5cb1785d97b0c3d1d1a16bc1d710c4a0049daefc4935f3a8f31f827f4d3d2e7f", size = 2544314, upload-time = "2026-02-11T04:22:26.685Z" }, + { url = "https://files.pythonhosted.org/packages/6c/9d/efd18493f9de13b87ede7c47e69184b9e859e4427225ea962e32e56a49bc/pillow-12.1.1-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:1f90cff8aa76835cba5769f0b3121a22bd4eb9e6884cfe338216e557a9a548b8", size = 5268612, upload-time = "2026-02-11T04:22:29.884Z" }, + { url = "https://files.pythonhosted.org/packages/f8/f1/4f42eb2b388eb2ffc660dcb7f7b556c1015c53ebd5f7f754965ef997585b/pillow-12.1.1-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:1f1be78ce9466a7ee64bfda57bdba0f7cc499d9794d518b854816c41bf0aa4e9", size = 4660567, upload-time = "2026-02-11T04:22:31.799Z" }, + { url = "https://files.pythonhosted.org/packages/01/54/df6ef130fa43e4b82e32624a7b821a2be1c5653a5fdad8469687a7db4e00/pillow-12.1.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:42fc1f4677106188ad9a55562bbade416f8b55456f522430fadab3cef7cd4e60", size = 6269951, upload-time = "2026-02-11T04:22:33.921Z" }, + { url = "https://files.pythonhosted.org/packages/a9/48/618752d06cc44bb4aae8ce0cd4e6426871929ed7b46215638088270d9b34/pillow-12.1.1-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:98edb152429ab62a1818039744d8fbb3ccab98a7c29fc3d5fcef158f3f1f68b7", size = 8074769, upload-time = "2026-02-11T04:22:35.877Z" }, + { url = "https://files.pythonhosted.org/packages/c3/bd/f1d71eb39a72fa088d938655afba3e00b38018d052752f435838961127d8/pillow-12.1.1-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d470ab1178551dd17fdba0fef463359c41aaa613cdcd7ff8373f54be629f9f8f", size = 6381358, upload-time = "2026-02-11T04:22:37.698Z" }, + { url = "https://files.pythonhosted.org/packages/64/ef/c784e20b96674ed36a5af839305f55616f8b4f8aa8eeccf8531a6e312243/pillow-12.1.1-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6408a7b064595afcab0a49393a413732a35788f2a5092fdc6266952ed67de586", size = 7068558, upload-time = "2026-02-11T04:22:39.597Z" }, + { url = "https://files.pythonhosted.org/packages/73/cb/8059688b74422ae61278202c4e1ad992e8a2e7375227be0a21c6b87ca8d5/pillow-12.1.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:5d8c41325b382c07799a3682c1c258469ea2ff97103c53717b7893862d0c98ce", size = 6493028, upload-time = "2026-02-11T04:22:42.73Z" }, + { url = "https://files.pythonhosted.org/packages/c6/da/e3c008ed7d2dd1f905b15949325934510b9d1931e5df999bb15972756818/pillow-12.1.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:c7697918b5be27424e9ce568193efd13d925c4481dd364e43f5dff72d33e10f8", size = 7191940, upload-time = "2026-02-11T04:22:44.543Z" }, + { url = "https://files.pythonhosted.org/packages/01/4a/9202e8d11714c1fc5951f2e1ef362f2d7fbc595e1f6717971d5dd750e969/pillow-12.1.1-cp314-cp314t-win32.whl", hash = "sha256:d2912fd8114fc5545aa3a4b5576512f64c55a03f3ebcca4c10194d593d43ea36", size = 6438736, upload-time = "2026-02-11T04:22:46.347Z" }, + { url = "https://files.pythonhosted.org/packages/f3/ca/cbce2327eb9885476b3957b2e82eb12c866a8b16ad77392864ad601022ce/pillow-12.1.1-cp314-cp314t-win_amd64.whl", hash = "sha256:4ceb838d4bd9dab43e06c363cab2eebf63846d6a4aeaea283bbdfd8f1a8ed58b", size = 7182894, upload-time = "2026-02-11T04:22:48.114Z" }, + { url = "https://files.pythonhosted.org/packages/ec/d2/de599c95ba0a973b94410477f8bf0b6f0b5e67360eb89bcb1ad365258beb/pillow-12.1.1-cp314-cp314t-win_arm64.whl", hash = "sha256:7b03048319bfc6170e93bd60728a1af51d3dd7704935feb228c4d4faab35d334", size = 2546446, upload-time = "2026-02-11T04:22:50.342Z" }, + { url = "https://files.pythonhosted.org/packages/56/11/5d43209aa4cb58e0cc80127956ff1796a68b928e6324bbf06ef4db34367b/pillow-12.1.1-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:600fd103672b925fe62ed08e0d874ea34d692474df6f4bf7ebe148b30f89f39f", size = 5228606, upload-time = "2026-02-11T04:22:52.106Z" }, + { url = "https://files.pythonhosted.org/packages/5f/d5/3b005b4e4fda6698b371fa6c21b097d4707585d7db99e98d9b0b87ac612a/pillow-12.1.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:665e1b916b043cef294bc54d47bf02d87e13f769bc4bc5fa225a24b3a6c5aca9", size = 4622321, upload-time = "2026-02-11T04:22:53.827Z" }, + { url = "https://files.pythonhosted.org/packages/df/36/ed3ea2d594356fd8037e5a01f6156c74bc8d92dbb0fa60746cc96cabb6e8/pillow-12.1.1-pp311-pypy311_pp73-manylinux2014_aarch64.manylinux_2_17_aarch64.whl", hash = "sha256:495c302af3aad1ca67420ddd5c7bd480c8867ad173528767d906428057a11f0e", size = 5247579, upload-time = "2026-02-11T04:22:56.094Z" }, + { url = "https://files.pythonhosted.org/packages/54/9a/9cc3e029683cf6d20ae5085da0dafc63148e3252c2f13328e553aaa13cfb/pillow-12.1.1-pp311-pypy311_pp73-manylinux2014_x86_64.manylinux_2_17_x86_64.whl", hash = "sha256:8fd420ef0c52c88b5a035a0886f367748c72147b2b8f384c9d12656678dfdfa9", size = 6989094, upload-time = "2026-02-11T04:22:58.288Z" }, + { url = "https://files.pythonhosted.org/packages/00/98/fc53ab36da80b88df0967896b6c4b4cd948a0dc5aa40a754266aa3ae48b3/pillow-12.1.1-pp311-pypy311_pp73-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:f975aa7ef9684ce7e2c18a3aa8f8e2106ce1e46b94ab713d156b2898811651d3", size = 5313850, upload-time = "2026-02-11T04:23:00.554Z" }, + { url = "https://files.pythonhosted.org/packages/30/02/00fa585abfd9fe9d73e5f6e554dc36cc2b842898cbfc46d70353dae227f8/pillow-12.1.1-pp311-pypy311_pp73-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8089c852a56c2966cf18835db62d9b34fef7ba74c726ad943928d494fa7f4735", size = 5963343, upload-time = "2026-02-11T04:23:02.934Z" }, + { url = "https://files.pythonhosted.org/packages/f2/26/c56ce33ca856e358d27fda9676c055395abddb82c35ac0f593877ed4562e/pillow-12.1.1-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:cb9bb857b2d057c6dfc72ac5f3b44836924ba15721882ef103cecb40d002d80e", size = 7029880, upload-time = "2026-02-11T04:23:04.783Z" }, +] + +[[package]] +name = "platformdirs" +version = "4.9.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/1b/04/fea538adf7dbbd6d186f551d595961e564a3b6715bdf276b477460858672/platformdirs-4.9.2.tar.gz", hash = "sha256:9a33809944b9db043ad67ca0db94b14bf452cc6aeaac46a88ea55b26e2e9d291", size = 28394, upload-time = "2026-02-16T03:56:10.574Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/48/31/05e764397056194206169869b50cf2fee4dbbbc71b344705b9c0d878d4d8/platformdirs-4.9.2-py3-none-any.whl", hash = "sha256:9170634f126f8efdae22fb58ae8a0eaa86f38365bc57897a6c4f781d1f5875bd", size = 21168, upload-time = "2026-02-16T03:56:08.891Z" }, +] + +[[package]] +name = "plotly" +version = "5.24.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "packaging" }, + { name = "tenacity" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/79/4f/428f6d959818d7425a94c190a6b26fbc58035cbef40bf249be0b62a9aedd/plotly-5.24.1.tar.gz", hash = "sha256:dbc8ac8339d248a4bcc36e08a5659bacfe1b079390b8953533f4eb22169b4bae", size = 9479398, upload-time = "2024-09-12T15:36:31.068Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e5/ae/580600f441f6fc05218bd6c9d5794f4aef072a7d9093b291f1c50a9db8bc/plotly-5.24.1-py3-none-any.whl", hash = "sha256:f67073a1e637eb0dc3e46324d9d51e2fe76e9727c892dde64ddf1e1b51f29089", size = 19054220, upload-time = "2024-09-12T15:36:24.08Z" }, +] + +[[package]] +name = "pluggy" +version = "1.6.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/f9/e2/3e91f31a7d2b083fe6ef3fa267035b518369d9511ffab804f839851d2779/pluggy-1.6.0.tar.gz", hash = "sha256:7dcc130b76258d33b90f61b658791dede3486c3e6bfb003ee5c9bfb396dd22f3", size = 69412, upload-time = "2025-05-15T12:30:07.975Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/54/20/4d324d65cc6d9205fabedc306948156824eb9f0ee1633355a8f7ec5c66bf/pluggy-1.6.0-py3-none-any.whl", hash = "sha256:e920276dd6813095e9377c0bc5566d94c932c33b27a3e3945d8389c374dd4746", size = 20538, upload-time = "2025-05-15T12:30:06.134Z" }, +] + +[[package]] +name = "prompt-toolkit" +version = "3.0.52" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "wcwidth" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/a1/96/06e01a7b38dce6fe1db213e061a4602dd6032a8a97ef6c1a862537732421/prompt_toolkit-3.0.52.tar.gz", hash = "sha256:28cde192929c8e7321de85de1ddbe736f1375148b02f2e17edd840042b1be855", size = 434198, upload-time = "2025-08-27T15:24:02.057Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/84/03/0d3ce49e2505ae70cf43bc5bb3033955d2fc9f932163e84dc0779cc47f48/prompt_toolkit-3.0.52-py3-none-any.whl", hash = "sha256:9aac639a3bbd33284347de5ad8d68ecc044b91a762dc39b7c21095fcd6a19955", size = 391431, upload-time = "2025-08-27T15:23:59.498Z" }, +] + +[[package]] +name = "propcache" +version = "0.5.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ec/44/c87281c333769159c50594f22610f77398a47ccbfbbf23074e744e86f87c/propcache-0.5.2.tar.gz", hash = "sha256:01c4fc7480cd0598bb4b57022df55b9ca296da7fc5a8760bd8451a7e63a7d427", size = 50208, upload-time = "2026-05-08T21:02:12.199Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e7/f1/8a8cc1c2c7e7934ab77e0163414f736fadbc0f5e8dd9673b952355ac175b/propcache-0.5.2-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:74b70780220e2dd89175ca24b81b68b67c83db499ae611e7f2313cb329801c78", size = 90744, upload-time = "2026-05-08T20:59:45.799Z" }, + { url = "https://files.pythonhosted.org/packages/c2/f4/651b1225e976bd1a2ba5cfba0c29d096581c2636b437e3a9a7ab6276270a/propcache-0.5.2-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:a4840ab0ae0216d952f4b53dc6d0b992bfc2bedbfe360bdd9b548bc184c08959", size = 52033, upload-time = "2026-05-08T20:59:47.408Z" }, + { url = "https://files.pythonhosted.org/packages/15/a8/8ede85d6aa1f79fc7dc2f8fd2c8d65920b8272c3892903c8a1affde48cfb/propcache-0.5.2-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:c6844ba6364fb12f403928a82cfd295ab103a2b315c77c747b2dbe4a41894ea7", size = 52754, upload-time = "2026-05-08T20:59:49.202Z" }, + { url = "https://files.pythonhosted.org/packages/7d/fe/b3551b41bbc2f5b5bb088fc6920567cd43101253e68fbaa261339eb96fe1/propcache-0.5.2-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:2293949b855ce597f2826452d17c2d545fb5622379c4ea6fdf525e9b8e8a2511", size = 57573, upload-time = "2026-05-08T20:59:50.778Z" }, + { url = "https://files.pythonhosted.org/packages/83/27/ab851ebd1b7172e3e161f5f8d39e315d54a91bea246f01f4d872d3376aef/propcache-0.5.2-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:0fd59b5af35f74da48d905dcbad55449ba13be91823cb05a9bd590bbf5b61660", size = 60645, upload-time = "2026-05-08T20:59:52.227Z" }, + { url = "https://files.pythonhosted.org/packages/95/7d/466b3d18022e9897cbda9c735c493c5bd747d7a4c6f5ea1480b4cec434b6/propcache-0.5.2-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:29f9309a2e42b0d273be006fdb4be2d6c39a47f6f57d8fb1cf9f81481df81b66", size = 61563, upload-time = "2026-05-08T20:59:53.866Z" }, + { url = "https://files.pythonhosted.org/packages/27/1b/16ab7f2cf2041da2f60d156ba64c2484eadf9168075b4ff43c3ef60045af/propcache-0.5.2-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:5aaa2b923c1944ac8febd6609cb373540a5563e7cbcb0fd770f75dace2eb817b", size = 58888, upload-time = "2026-05-08T20:59:55.457Z" }, + { url = "https://files.pythonhosted.org/packages/0a/67/bb777ffd907633563bf35fd859c4ce97b0512c32f4633cf5d1eb7c33512b/propcache-0.5.2-cp311-cp311-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:66ea454f095ddf5b6b14f56c064c0941c4788be11e18d2464cf643bf7203ff67", size = 59253, upload-time = "2026-05-08T20:59:57.075Z" }, + { url = "https://files.pythonhosted.org/packages/b9/42/64f8d90b73fd9cdc1499b48057ff6d9cd2a98a25734c9bb62ecf07e87061/propcache-0.5.2-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:95f1e3f4760d404b13c9976c0229b2b49a3c8e2c62a9ce92efdd2b11ada75e3f", size = 57558, upload-time = "2026-05-08T20:59:58.602Z" }, + { url = "https://files.pythonhosted.org/packages/eb/02/dba5bc03c9041f2092ea55a449caf5dfe68352c6654511b29ba0654ddb69/propcache-0.5.2-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:85341b12b9d55bad0bded24cac341bb34289469e03a11f3f583ea1cc1db0326c", size = 55007, upload-time = "2026-05-08T20:59:59.837Z" }, + { url = "https://files.pythonhosted.org/packages/14/c0/43f649c7aa2a77a3b100d84e9dea3a483120ecb608bfe36ce49eaff517fe/propcache-0.5.2-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:26a4dca084132874e639895c3135dfad5eb20bae209f62d1aeb31b03e601c3c0", size = 60355, upload-time = "2026-05-08T21:00:01.144Z" }, + { url = "https://files.pythonhosted.org/packages/83/c0/435dafd27f1cb4a495381dae60e25883ccfe4020bb72818e8184c1678092/propcache-0.5.2-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:3b199b9b2b3d6a7edf3183ba8a9a137a22b97f7df525feb5ae1eccf026d2a9c6", size = 59057, upload-time = "2026-05-08T21:00:02.401Z" }, + { url = "https://files.pythonhosted.org/packages/53/ae/6e292df9135d659944e96cb3389258e4a663e5b2b5f6c217ef0ddc8d2f73/propcache-0.5.2-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:e59bc9e66329185b93dab73f210f1a37f81cb40f321501db8017c9aea15dba27", size = 61938, upload-time = "2026-05-08T21:00:03.638Z" }, + { url = "https://files.pythonhosted.org/packages/0b/42/314ebc50d8159055411fd6b0bda322ff510e4b1f7d2e4927940ad0f6af20/propcache-0.5.2-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:552ffadf6ad409844bc5919c42a0a83d88314cedddaea0e41e80a8b8fffe881f", size = 59731, upload-time = "2026-05-08T21:00:04.881Z" }, + { url = "https://files.pythonhosted.org/packages/b8/9b/2da6dee38871c3c8772fabc2758325a5c9077d6d18c597737dc04dd884cd/propcache-0.5.2-cp311-cp311-win32.whl", hash = "sha256:cd416c1de191973c52ff1a12a57446bfc7642797b282d7caf2162d7d1b8aa9a0", size = 38966, upload-time = "2026-05-08T21:00:06.511Z" }, + { url = "https://files.pythonhosted.org/packages/42/4e/f17363fb58c0afe05b067361cb6d86ed2d29de6506779a27547c4d183075/propcache-0.5.2-cp311-cp311-win_amd64.whl", hash = "sha256:44e488ef40dbb452700b2b1f8188934121f6648f52c295055662d2191959ff82", size = 42135, upload-time = "2026-05-08T21:00:08.088Z" }, + { url = "https://files.pythonhosted.org/packages/c6/eb/6af6685077d22e8b33358d3c548e3282706a0b3cd85044ffba4e5dd08e3b/propcache-0.5.2-cp311-cp311-win_arm64.whl", hash = "sha256:54adaa85a22078d1e306304a40984dc5be99d599bf3dc0a24dc98f7daeab89ab", size = 38381, upload-time = "2026-05-08T21:00:09.692Z" }, + { url = "https://files.pythonhosted.org/packages/4a/cb/e27bc2b2737a0bb49962b275efa051e8f1c35a936df7d5139b6b658b7dc9/propcache-0.5.2-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:806719138ecd720339a12410fb9614ac9b2b2d3a5fdf8235d56981c36f4039ba", size = 95887, upload-time = "2026-05-08T21:00:11.277Z" }, + { url = "https://files.pythonhosted.org/packages/e6/13/b8ae04c59392f8d11c6cd9fb4011d1dc7c86b81225c770280300e259ffe1/propcache-0.5.2-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:db2b80ea58eab4f86b2beec3cc8b39e8ff9276ac20e96b7cce43c8ae84cd6b5a", size = 54654, upload-time = "2026-05-08T21:00:12.604Z" }, + { url = "https://files.pythonhosted.org/packages/2c/7d/49777a3e20b55863d4794384a38acd460c04157b0a00f8602b0d508b8431/propcache-0.5.2-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:e5cbfac9f61484f7e9f3597775500cd3ebe8274e9b050c38f9525c77c97520bf", size = 55190, upload-time = "2026-05-08T21:00:13.935Z" }, + { url = "https://files.pythonhosted.org/packages/44/c7/085d0cd63062e84044e3f05797749c3f8e3938ff3aeb0eb2f69d43fafc91/propcache-0.5.2-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5dbc581d2814337da56222fab8dc5f161cd798a434e49bac27930aaef798e144", size = 59995, upload-time = "2026-05-08T21:00:15.526Z" }, + { url = "https://files.pythonhosted.org/packages/9c/42/32cf8e3009e92b2645cf1e944f701e8ea4e924dffde1ee26db860bcbf7e4/propcache-0.5.2-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:857187f381f88c8e2fa2fe56ab94879d011b883d5a2ee5a1b60a8cd2a06846d9", size = 63422, upload-time = "2026-05-08T21:00:16.824Z" }, + { url = "https://files.pythonhosted.org/packages/9e/1b/f112433f99fc979431b87a39ef169e3f8df070d99a72792c56d6937ac48b/propcache-0.5.2-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:178b4a2cdaac1818e2bf1c5a99b94383fa73ea5382e032a48dec07dc5668dc42", size = 64342, upload-time = "2026-05-08T21:00:18.362Z" }, + { url = "https://files.pythonhosted.org/packages/14/15/5574111ae50dd6e879456888c0eadd4c5a869959775854e18e18a6b345f3/propcache-0.5.2-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6f328175a2cde1f0ff2c4ed8ce968b9dcfb55f3a7153f39e2957ed994da13476", size = 61639, upload-time = "2026-05-08T21:00:19.692Z" }, + { url = "https://files.pythonhosted.org/packages/cc/da/4d775080b1490c0ae604acda868bd71aabe3a89ed16f2aa4339eb8a283e7/propcache-0.5.2-cp312-cp312-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:5671d09a36b06d0fd4a3da0fccbcae360e9b1570924171a15e9e0997f0249fba", size = 61588, upload-time = "2026-05-08T21:00:21.155Z" }, + { url = "https://files.pythonhosted.org/packages/04/ac/f076982cbe2195ee9cf32de5a1e46951d9fb399fc207f390562dd0fd8fb2/propcache-0.5.2-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:80168e2ebe4d3ec6599d10ad8f520304ae1cad9b6c5a95372aef1b66b7bfb53a", size = 60029, upload-time = "2026-05-08T21:00:22.713Z" }, + { url = "https://files.pythonhosted.org/packages/70/60/189be62e0dd898dce3b331e1b8c7a543cd3a405ac0c81fe8ee8a9d5d77e1/propcache-0.5.2-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:45f11346f884bc47444f6e6647131055844134c3175b629f84952e2b5cd62b64", size = 56774, upload-time = "2026-05-08T21:00:24.001Z" }, + { url = "https://files.pythonhosted.org/packages/ea/9e/93377b9c7939c1ffae98f878dee955efadfd638078bc86dbc21f9d52f651/propcache-0.5.2-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:8e778ebd44ef4f66ed60a0416b06b489687db264a9c0b3620362f26489492913", size = 63532, upload-time = "2026-05-08T21:00:25.545Z" }, + { url = "https://files.pythonhosted.org/packages/14/f9/590ef6cfb9b8028d516d287812ece32bb0bc5f11fbb9c8bf6b2e6313fec8/propcache-0.5.2-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:c0cb9ed24c8964e172768d455a38254c2dd8a552905729ce006cad3d3dda59b1", size = 61592, upload-time = "2026-05-08T21:00:27.186Z" }, + { url = "https://files.pythonhosted.org/packages/b4/5e/70958b3034c297a630bba2f17ca7abc2d5f39a803ad7e370ab79d1ecd022/propcache-0.5.2-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:1d1ad32d9d4355e2be65574fd0bfd3677e7066b009cd5b9b2dee8aa6a6393b33", size = 64788, upload-time = "2026-05-08T21:00:28.8Z" }, + { url = "https://files.pythonhosted.org/packages/12/fd/77fe5936d8c3086ca9048f7f415f122ed82e53884a9ec193646b42deef06/propcache-0.5.2-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:c80f4ba3e8f00189165999a742ee526ebeccedf6c3f7beb0c7df821e9772435a", size = 62514, upload-time = "2026-05-08T21:00:30.098Z" }, + { url = "https://files.pythonhosted.org/packages/cf/74/66bd798b5b3be70aa1b391f5cc9d6a0a5532d7fd3b19ec0b213e72e6ad9d/propcache-0.5.2-cp312-cp312-win32.whl", hash = "sha256:8c7972d8f193740d9175f0998ab38717e6cd322d5935c5b0fef8c0d323fd9031", size = 39018, upload-time = "2026-05-08T21:00:31.622Z" }, + { url = "https://files.pythonhosted.org/packages/61/7c/5c0d34aa3024694d6dcb9271cdbdd08c4e47c1c0ad95ec7e7bc74cdea145/propcache-0.5.2-cp312-cp312-win_amd64.whl", hash = "sha256:d9ee8826a7d47863a08ac44e1a5f611a462eefc3a194b492da242128bec75b42", size = 42322, upload-time = "2026-05-08T21:00:32.918Z" }, + { url = "https://files.pythonhosted.org/packages/4d/91/875812f1a3feb20ceba818ef39fbe4d92f1081e04ac815c822496d0d038b/propcache-0.5.2-cp312-cp312-win_arm64.whl", hash = "sha256:2800a4a8ead6b28cccd1ec54b59346f0def7922ee1c7598e8499c733cfbb7c84", size = 38172, upload-time = "2026-05-08T21:00:35.124Z" }, + { url = "https://files.pythonhosted.org/packages/c5/09/f049e45385503fe67db75a6b6186a7b9f0c3930366dc960522c312a825b1/propcache-0.5.2-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:099aaf4b4d1a02265b92a977edf00b5c4f63b3b17ac6de39b0d637c9cac0188a", size = 94457, upload-time = "2026-05-08T21:00:36.355Z" }, + { url = "https://files.pythonhosted.org/packages/6b/65/83d1d05655baf63113731bd5a1008435e14f8d1e5a06cbe4ec5b23ad7a31/propcache-0.5.2-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:68ce1c44c7a813a7f71ea04315a8c7b330b63db99d059a797a4651bb6f69f117", size = 53835, upload-time = "2026-05-08T21:00:38.072Z" }, + { url = "https://files.pythonhosted.org/packages/a9/12/a6ba6482bb5ea3260c000c9b20881c95fa11c6b30173715668259f844ed7/propcache-0.5.2-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:fc299c129490f55f254cd90be0deca4764e36e9a7c08b4aa588479a3bbed3098", size = 54545, upload-time = "2026-05-08T21:00:39.319Z" }, + { url = "https://files.pythonhosted.org/packages/a9/19/7fa086f5764c59ec8a8e157cd93aa8497acc00aba9dcdec56bfffb32602d/propcache-0.5.2-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a6ae2198be502c10f09b2516e7b5d019816924bc3183a43ce792a7bd6625e6f4", size = 59886, upload-time = "2026-05-08T21:00:40.621Z" }, + { url = "https://files.pythonhosted.org/packages/a1/e4/5d7663dc8235956c8f5281698a3af1d351d8820341ddd890f59d9a9127f2/propcache-0.5.2-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:6041d31504dc1779d700e1edcfb08eea334b357620b06681a4eabb57a74e574e", size = 63261, upload-time = "2026-05-08T21:00:41.775Z" }, + { url = "https://files.pythonhosted.org/packages/4a/4a/15a03adee24d6350da4292caeac44c34c033d2afe5e87eb370f38854560f/propcache-0.5.2-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:f7eabc04151c78a9f4d5bbb5f1faf571e4defeb4b585e0fe95b60ff2dbe4d3d7", size = 64184, upload-time = "2026-05-08T21:00:43.018Z" }, + { url = "https://files.pythonhosted.org/packages/8b/c6/979176efdaa3d239e36d503d5af63a0a773b36662ed8f52e5b6a6d9fd40e/propcache-0.5.2-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:4db0ba63d693afd40d249bd93f842b5f144f8fcbb83de05660373bcf30517b1d", size = 61534, upload-time = "2026-05-08T21:00:44.507Z" }, + { url = "https://files.pythonhosted.org/packages/c8/22/63e8cd1bae4c2d2be6493b6b7d10566ddafad88137cfbc99964a1119853c/propcache-0.5.2-cp313-cp313-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:1dbcf7675229b35d31abb6547d8ebc8c27a830ac3f9a794edff6254873ec7c0a", size = 61500, upload-time = "2026-05-08T21:00:45.796Z" }, + { url = "https://files.pythonhosted.org/packages/60/5a/28e5d9acbac1cc9ccb67045e8c1b943aa8d79fdf39c93bd73cacd68008ea/propcache-0.5.2-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:d310c013aad2c72f1c3f2f8dd3279d460a858c551f97aeb8c63e4693cca7b4d2", size = 59994, upload-time = "2026-05-08T21:00:47.093Z" }, + { url = "https://files.pythonhosted.org/packages/f3/40/db650677f554a95b9c01a7c9d93d629e93a15562f5deb4573c9ee136fed2/propcache-0.5.2-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:06187263ddad280d05b4d8a8b3bb7d164cbebd469236544a42e6d9b28ac6a4fa", size = 56884, upload-time = "2026-05-08T21:00:48.376Z" }, + { url = "https://files.pythonhosted.org/packages/80/45/70b39b89516ff8b96bf732fa6fded8cef20f293cb1508690101c3c07ec51/propcache-0.5.2-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:3115559b8effafd63b142ea5ed53d63a16ea6469cbc63dce4ee194b42db5d853", size = 63464, upload-time = "2026-05-08T21:00:49.954Z" }, + { url = "https://files.pythonhosted.org/packages/f9/e2/fa59d3a89eac5534293124af4f1d0d0ada091ce4a0ab4610ce03fd2bdd8d/propcache-0.5.2-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:c60462af8e6dc30c35407c7237ea908d777b22862bbee27bc4699c0d8bcdc45a", size = 61588, upload-time = "2026-05-08T21:00:51.281Z" }, + { url = "https://files.pythonhosted.org/packages/0b/97/efb547a55c4bc7381cfb202d6a2239ac621045277bc1ea5dfd3a7f0516c0/propcache-0.5.2-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:40314bca9ac559716fe374094fc81c11dcc34b64fd6c585360f5775690505704", size = 64667, upload-time = "2026-05-08T21:00:52.602Z" }, + { url = "https://files.pythonhosted.org/packages/92/56/f5c7d9b4b7595d5127da38974d791b2153f3d1eae6c674af3583ace92ad3/propcache-0.5.2-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:cfa21e036ce1e1db2be04ba3b85d2df1bb1702fa01932d984c5464c665228ff4", size = 62463, upload-time = "2026-05-08T21:00:54.303Z" }, + { url = "https://files.pythonhosted.org/packages/bd/3b/484a3a65fc9f9f60c41dcd17b428bace5389544e2c680994534a20755066/propcache-0.5.2-cp313-cp313-win32.whl", hash = "sha256:f156a3529f38063b6dbaf356e15602a7f95f8055b1295a438433a6386f10463d", size = 38621, upload-time = "2026-05-08T21:00:55.808Z" }, + { url = "https://files.pythonhosted.org/packages/1c/fd/3f0f10dba4dabad3bf53102be007abf55481067952bde0fdddff439e7c61/propcache-0.5.2-cp313-cp313-win_amd64.whl", hash = "sha256:dfed59d0a5aeb01e242e66ff0300bc4a265a7c05f612d30016f0b60b1017d757", size = 41649, upload-time = "2026-05-08T21:00:57.061Z" }, + { url = "https://files.pythonhosted.org/packages/90/ec/6ce619cc32bb500a482f811f9cd509368b4e58e638d13f2c68f370d6b475/propcache-0.5.2-cp313-cp313-win_arm64.whl", hash = "sha256:ba338430e87ceb9c8f0cf754de38a9860560261e56c00376debd628698a7364f", size = 37636, upload-time = "2026-05-08T21:00:58.646Z" }, + { url = "https://files.pythonhosted.org/packages/1b/82/c1d268bbbf2ef981c5bf0fbbe746db617c66e3bcefe431a1aa8943fbe23a/propcache-0.5.2-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:a592f5f3da71c8691c788c13cb6734b6d17663d2e1cb8caddf0673d01ef8847d", size = 98872, upload-time = "2026-05-08T21:00:59.889Z" }, + { url = "https://files.pythonhosted.org/packages/f4/d4/52c871e73e864e6b34c0e2d58ac1ec5ccd149497ddc7ad2137ae98323a35/propcache-0.5.2-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:6a997d0489e9668a384fcfd5061b857aa5361de73191cac204d04b889cfbbafa", size = 56257, upload-time = "2026-05-08T21:01:01.195Z" }, + { url = "https://files.pythonhosted.org/packages/67/f0/9b90ca2a210b3d09bcfcd96ecd0f55545c091535abce2a45de2775cfd357/propcache-0.5.2-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:10734b5484ea113152ee25a91dccedf81631791805d2c9ccb054958e51842c94", size = 56696, upload-time = "2026-05-08T21:01:02.941Z" }, + { url = "https://files.pythonhosted.org/packages/9d/0e/6e9d4ba07c8e56e21ddec1e75f12148142b21ca83a51871babce095334f4/propcache-0.5.2-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:cafca7e56c12bb02ae16d283742bef25a61122e9dab2b5b3f2ccbe589ce32164", size = 62378, upload-time = "2026-05-08T21:01:04.475Z" }, + { url = "https://files.pythonhosted.org/packages/65/19/c10badaa463dde8a27ce884f8ee2ec37e6035b7c9f5ff0c8f74f06f08dac/propcache-0.5.2-cp313-cp313t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f064f8d2b59177878b7615df1735cd8fe3462ed6be8c7b217d17a276489c2b7f", size = 65283, upload-time = "2026-05-08T21:01:05.959Z" }, + { url = "https://files.pythonhosted.org/packages/b0/b6/93bea99ca80e19cef6512a8580e5b7857bbe09422d9daa7fd4ef5723306c/propcache-0.5.2-cp313-cp313t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:f78abfa8dfc32376fd1aacf597b2f2fbbe0ea751419aee718af5d4f82537ef8c", size = 66616, upload-time = "2026-05-08T21:01:07.228Z" }, + { url = "https://files.pythonhosted.org/packages/83/e4/5c7462e50625f051f37fb38b8224f7639f667184bbd34424ec83819bb1b7/propcache-0.5.2-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:f7467da8a9822bf1a55336f877340c5bcbd3c482afc43a99771169f74a26dedc", size = 63773, upload-time = "2026-05-08T21:01:08.514Z" }, + { url = "https://files.pythonhosted.org/packages/ca/b6/99238894047b13c823be25027e736626cd414a52a5e30d2c3347c2733529/propcache-0.5.2-cp313-cp313t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:a6ddc6ac9e25de626c1f129c1b467d7ecd33ce2237d3fd0c4e429feef0a7ee1f", size = 63664, upload-time = "2026-05-08T21:01:09.874Z" }, + { url = "https://files.pythonhosted.org/packages/85/1e/a3a1a63116a2b8edb415a8bb9a6f0c34bd03830b1e18e8ce2904e1dc1cf4/propcache-0.5.2-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:2f22cbbac9e26a8e864c0985ff1268d5d939d53d9d9411a9824279097e03a2cb", size = 62643, upload-time = "2026-05-08T21:01:11.132Z" }, + { url = "https://files.pythonhosted.org/packages/e4/03/893cf147de2fc6543c5eaa07ad833170e7e2a2385725bbebe8c0503723bb/propcache-0.5.2-cp313-cp313t-musllinux_1_2_armv7l.whl", hash = "sha256:fc76378c62a0f04d0cd82fbb1a2cd2d7e28fcb40d5873f28a6c44e388aaa2751", size = 59595, upload-time = "2026-05-08T21:01:12.387Z" }, + { url = "https://files.pythonhosted.org/packages/86/3b/04c1a2e12c57766568ba75ba72b3bf2042818d4c1425fab6fc07155c7cff/propcache-0.5.2-cp313-cp313t-musllinux_1_2_ppc64le.whl", hash = "sha256:acd2c8edba48e31e58a363b8cf4e5c7db3b04b3f9e371f601df30d9b0d244836", size = 65711, upload-time = "2026-05-08T21:01:13.676Z" }, + { url = "https://files.pythonhosted.org/packages/1c/34/80f8d0099f8d6bacc4de1624c85672681c8cd1149ca2da0e38fd120b817f/propcache-0.5.2-cp313-cp313t-musllinux_1_2_riscv64.whl", hash = "sha256:452b5065457eb9991ec5eb38ff41d6cd4c991c9ac7c531c4d5849ae473a9a13f", size = 64247, upload-time = "2026-05-08T21:01:14.936Z" }, + { url = "https://files.pythonhosted.org/packages/f3/1a/8b08f3a5f1037e9e370c55883ceeeee0f6dd0416fb2d2d67b8bfc91f2a79/propcache-0.5.2-cp313-cp313t-musllinux_1_2_s390x.whl", hash = "sha256:3430bb2bfe1331885c427745a751e774ee679fd4344f80b97bf879815fe8fa55", size = 67102, upload-time = "2026-05-08T21:01:16.281Z" }, + { url = "https://files.pythonhosted.org/packages/34/68/8bdb7bb7756d76e005490649d10e4a8369e610c74d619f71e1aedf889e9c/propcache-0.5.2-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:cef6cea3922890dd6c9654971001fa797b526c16ab5e1e46c05fd6f877be7568", size = 64964, upload-time = "2026-05-08T21:01:17.57Z" }, + { url = "https://files.pythonhosted.org/packages/0a/aa/50fb0b5d3968b61a510926ff8b8465f1d6e976b3ab74496d7a4b9fc42515/propcache-0.5.2-cp313-cp313t-win32.whl", hash = "sha256:72d61e16dd78228b58c5d47be830ff3da7e5f139abdf0aef9d86cde1c5cf2191", size = 42546, upload-time = "2026-05-08T21:01:18.946Z" }, + { url = "https://files.pythonhosted.org/packages/ae/4c/0ddbae64321bd4a95bcbfc19307238016b5b1fee645c84626c8d539e5b74/propcache-0.5.2-cp313-cp313t-win_amd64.whl", hash = "sha256:0958834041a0166d343b8d2cedcd8bcbaeb4fdbe0cf08320c5379f143c3be6e7", size = 46330, upload-time = "2026-05-08T21:01:20.162Z" }, + { url = "https://files.pythonhosted.org/packages/00/d9/9cddc8efb78d8af264c5ec9f6d10b62f57c515feda8d321595f56010fb23/propcache-0.5.2-cp313-cp313t-win_arm64.whl", hash = "sha256:6de8bd93ddde9b992cf2b2e0d796d501a19026b5b9fd87356d7d0779531a8d96", size = 40521, upload-time = "2026-05-08T21:01:21.399Z" }, + { url = "https://files.pythonhosted.org/packages/e2/ea/23ee535d90ce8bcc465a3028eb3cc0ce3bd1005f4bb27710b30587de798d/propcache-0.5.2-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:46088abff4cba581dea21ae0467a480526cb25aa5f3c269e909f800328bc3999", size = 94662, upload-time = "2026-05-08T21:01:22.683Z" }, + { url = "https://files.pythonhosted.org/packages/b5/06/c5a52f419b5d8972f8d46a7577476090d8e3263ff589ce40b5ca4968d5be/propcache-0.5.2-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:fc88b26f08d634f7bc819a7852e5214f5802641ab8d9fd5326892292eee1993e", size = 53928, upload-time = "2026-05-08T21:01:23.986Z" }, + { url = "https://files.pythonhosted.org/packages/63/b1/4260d67d6bd85e58a66b72d54ce15d5de789b6f3870cc6bedf8ff9667401/propcache-0.5.2-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:97797ebb098e670a2f92dd66f32897e30d7615b14e7f59711de23e30a9072539", size = 54650, upload-time = "2026-05-08T21:01:25.305Z" }, + { url = "https://files.pythonhosted.org/packages/70/06/2f46c318e3307cd7a6a7481def374ce838c0fe20084b39dd54b0879d0e99/propcache-0.5.2-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ba57fffe4ac99c5d30076161b5866336d97600769bad35cc68f7774b15298a4e", size = 59912, upload-time = "2026-05-08T21:01:26.545Z" }, + { url = "https://files.pythonhosted.org/packages/4c/29/fe1aebec2ce57ab985a9c382bded1124431f85078113aa222c5d278430d4/propcache-0.5.2-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:583c19759d9eec1e5b69e2fbef36a7d9c326041be9746cb822d335c8cedc2979", size = 63300, upload-time = "2026-05-08T21:01:27.937Z" }, + { url = "https://files.pythonhosted.org/packages/b4/18/2334b26768b6c82be8c69e83671b767d5ef426aa09b0cba6c2ea47816774/propcache-0.5.2-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:d0326e2e5e1f3163fa306c834e48e8d490e5fae607a097a40c0648109b47ba80", size = 64208, upload-time = "2026-05-08T21:01:29.484Z" }, + { url = "https://files.pythonhosted.org/packages/2b/76/7f1bfd6afff4c5e38e36a3c6d68eb5f4b7311ea80baf693db78d95b603c4/propcache-0.5.2-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:e00820e192c8dbebcafb383ebbf99030895f09905e7a0eb2e0340a0bcc2bc825", size = 61633, upload-time = "2026-05-08T21:01:31.068Z" }, + { url = "https://files.pythonhosted.org/packages/c4/46/b3ff8aba2b4953a3e50de2cf72f1b5748b8eca93b15f3dc2c84339084c09/propcache-0.5.2-cp314-cp314-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:c66afea89b1e43725731d2004732a046fe6fe955d51f952c3e95a7314a284a39", size = 61724, upload-time = "2026-05-08T21:01:32.374Z" }, + { url = "https://files.pythonhosted.org/packages/c5/01/814cfcafbcff954f94c01cf30e097ddc88a076b5440fbcf4570753437d40/propcache-0.5.2-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:d4dc37dec6c6cdad0b57881a5658fd14fbf53e333b1a86cf86559f190e1d9ec4", size = 60069, upload-time = "2026-05-08T21:01:33.67Z" }, + { url = "https://files.pythonhosted.org/packages/da/68/5c6f7622d510cc666a300687e06fd060c1a43361c0c9b20d284f06d8096a/propcache-0.5.2-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:5570dbcc97571c15f68068e529c92715a12f8d54030e272d264b377e22bd17a5", size = 57099, upload-time = "2026-05-08T21:01:34.915Z" }, + { url = "https://files.pythonhosted.org/packages/55/27/9cb0b4c679124085327957d42521c99dba04c88c90c3e55a6f0b633ebccc/propcache-0.5.2-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:f814362777a9f841adddb200ecdf8f5cb1e5a3c4b7a86378edbd6ccb26edd702", size = 63391, upload-time = "2026-05-08T21:01:36.231Z" }, + { url = "https://files.pythonhosted.org/packages/f0/9d/7258aaa5bdf60fc6f27591eef6fe52768cb0beda7140be477c8b12c9794a/propcache-0.5.2-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:196913dea116aeb5a2ba95af4ddcb7ea85559ae07d8eee8751688310d09168c3", size = 61626, upload-time = "2026-05-08T21:01:37.545Z" }, + { url = "https://files.pythonhosted.org/packages/8e/0d/41c602003e8a9b16fe1e7eadf62c7bfba9d5474370b24200bf48b315f45f/propcache-0.5.2-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:6e7b8719005dd1175be4ab1cd25e9b98659a5e0347331506ec6760d2773a7fb5", size = 64781, upload-time = "2026-05-08T21:01:38.83Z" }, + { url = "https://files.pythonhosted.org/packages/8b/f3/38e66b1856e9bd079deea015bc4a55f7767c0e4db2f7dcf69e7e680ba4ce/propcache-0.5.2-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:51f96d685ab16e88cab128cd37a52c5da540809c8b879fa047731bfcb4ad35a4", size = 62570, upload-time = "2026-05-08T21:01:40.415Z" }, + { url = "https://files.pythonhosted.org/packages/95/ca/bbfe9b910ce57dde8bb4876b4520fc02a4e89497c10de26be936758a3aaa/propcache-0.5.2-cp314-cp314-win32.whl", hash = "sha256:cc6fc3cc62e8501d3ed62894425040d2728ecddb1ed072737a5c70bd537aa9f0", size = 39436, upload-time = "2026-05-08T21:01:41.654Z" }, + { url = "https://files.pythonhosted.org/packages/61/d2/45c9defbaa1ea297035d9d4cce9e8f80daafbf19319c6007f157c6256ea9/propcache-0.5.2-cp314-cp314-win_amd64.whl", hash = "sha256:81e3a30b0bb60caa22033dd0f8a3618d1d67356212514f62c57db75cb0ef410c", size = 42373, upload-time = "2026-05-08T21:01:43.041Z" }, + { url = "https://files.pythonhosted.org/packages/44/68/9ea5103f41d5217d7d6ec24db90018e23aebec070c3f9a6e54d12b841fd8/propcache-0.5.2-cp314-cp314-win_arm64.whl", hash = "sha256:0d2c9bf8528f135dbb805ce027567e09164f7efa51a2be07458a2c0420f292d0", size = 38554, upload-time = "2026-05-08T21:01:44.336Z" }, + { url = "https://files.pythonhosted.org/packages/8a/81/fadf555f42d3b762eea8a53950b0489fdc0aa9da5f8ed9e10ce0a4e01b48/propcache-0.5.2-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:4bc8ff1feffc6a61c7002ffe84634c41b822e104990ae009f44a0834430070bb", size = 99395, upload-time = "2026-05-08T21:01:45.883Z" }, + { url = "https://files.pythonhosted.org/packages/f5/c9/c61e134a686949cf7971af3a390148b1156f7be81c73bc0cd12c873e2d48/propcache-0.5.2-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:79aa3ff0a9b566633b642fa9caf7e21ed1c13d6feca718187873f199e1514078", size = 56653, upload-time = "2026-05-08T21:01:47.307Z" }, + { url = "https://files.pythonhosted.org/packages/cb/73/daf935ea7048ddd7ec8eec5345b4a40b619d2d178b3c0a0900796bc3c794/propcache-0.5.2-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:1b31822f4474c4036bae62de9402710051d431a606d6a0f907fec79935a071aa", size = 56914, upload-time = "2026-05-08T21:01:48.573Z" }, + { url = "https://files.pythonhosted.org/packages/79/9f/aba959b435ea18617edd7cf0a7ad0b9c574b8fc7e3d2cd55fb59cb255d33/propcache-0.5.2-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:13fef48778b5a2a756523fdb781326b028ca75e32858b04f2cdd19f394564917", size = 62567, upload-time = "2026-05-08T21:01:49.903Z" }, + { url = "https://files.pythonhosted.org/packages/6c/a1/859942de9a791ff42f6141736f5b37749b8f53e65edfa49638c67dd67e6a/propcache-0.5.2-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:8b73ab70f1a3351fbc71f663b3e645af6dd0329100c353081cf69c37433fc6fe", size = 65542, upload-time = "2026-05-08T21:01:51.204Z" }, + { url = "https://files.pythonhosted.org/packages/b5/61/315bc0fd6c0fc7f80a528b8afd209e5fc4a875ea79571b91b8f50f442907/propcache-0.5.2-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:5538d2c13d93e4698af7e092b57bc7298fd35d1d58e656ae18f23ee0d0378e03", size = 66845, upload-time = "2026-05-08T21:01:52.539Z" }, + { url = "https://files.pythonhosted.org/packages/47/f7/9f8122e3132e8e354ac41975ef8f1099be7d5a16bc7ae562734e993665c0/propcache-0.5.2-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:cd645f03898405cabe694fb8bc35241e3a9c332ec85627584fe3de201452b335", size = 63985, upload-time = "2026-05-08T21:01:53.847Z" }, + { url = "https://files.pythonhosted.org/packages/c8/54/c317819ec157cbf6f35df9df9657a6f82daf34d5faf15948b2f639c2192e/propcache-0.5.2-cp314-cp314t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:a473b3440261e0c60706e732b2ed2f517857344fc21bf48fdfe211e2d98eb285", size = 63999, upload-time = "2026-05-08T21:01:55.179Z" }, + { url = "https://files.pythonhosted.org/packages/5a/56/387e3f7dfce0a9233df41fb888aa1c30222cb4bbbf09537c02dd9bd85fe2/propcache-0.5.2-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:7afa37062e6650640e932e4cc9297d81f9f42d9944029cc386b8247dea4da837", size = 62779, upload-time = "2026-05-08T21:01:57.489Z" }, + { url = "https://files.pythonhosted.org/packages/a1/9c/596784cb5824ed61ee960d3f8655a3f0993e107c6e98ab6c818b7fb92ccb/propcache-0.5.2-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:8a90efd5777e996e42d568db9ac740b944d691e565cbfd31b2f7832f9184b2b8", size = 59796, upload-time = "2026-05-08T21:01:58.736Z" }, + { url = "https://files.pythonhosted.org/packages/c2/3d/1a6cfa1726a48542c1e8784a0761421476a5b68e09b7f36bf95eb954aaba/propcache-0.5.2-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:f19bb891234d72535764d703bfed1153cc34f4214d5bd7150aee1eec9e8f4366", size = 66023, upload-time = "2026-05-08T21:02:00.228Z" }, + { url = "https://files.pythonhosted.org/packages/e4/0e/05fd6990369477076e4e280bcb970de760fddf0161a46e988bc95f7940ec/propcache-0.5.2-cp314-cp314t-musllinux_1_2_riscv64.whl", hash = "sha256:32775082acd2d807ee3db715c7770d38767b817870acfa08c29e057f3c4d5b56", size = 64448, upload-time = "2026-05-08T21:02:01.888Z" }, + { url = "https://files.pythonhosted.org/packages/cd/86/5f8da315a4309c62c10c0b2516b17492d5d3bbe1bb862b96604db67e2a37/propcache-0.5.2-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:9282fb1a3bccd038da9f768b927b24a0c753e466c086b7c4f3c6982851eefb2d", size = 67329, upload-time = "2026-05-08T21:02:03.484Z" }, + { url = "https://files.pythonhosted.org/packages/da/d3/3368efe79ab21f0cdf86ef49895811c9cc933131d4cde1f28a624e22e712/propcache-0.5.2-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:cc49723e2f60d6b32a0f0b08a3fd6d13203c07f1cd9566cfce0f12a917c967a2", size = 65172, upload-time = "2026-05-08T21:02:04.745Z" }, + { url = "https://files.pythonhosted.org/packages/d5/07/127e8b0bacfb325396196f9d976a22453049b89b9b2b08477cc3145faa44/propcache-0.5.2-cp314-cp314t-win32.whl", hash = "sha256:2d7aa89ebca5acc98cba9d1472d976e394782f587bad6661003602a619fd1821", size = 43813, upload-time = "2026-05-08T21:02:06.025Z" }, + { url = "https://files.pythonhosted.org/packages/88/fb/46dad6c0ae49ed230ab1b16c890c2b6314e2403e6c412976f4a72d64a527/propcache-0.5.2-cp314-cp314t-win_amd64.whl", hash = "sha256:d447bb0b3054be5818458fbb171208b1d9ff11eba14e18ca18b90cbb45767370", size = 47764, upload-time = "2026-05-08T21:02:07.353Z" }, + { url = "https://files.pythonhosted.org/packages/e7/c4/a47d0a63aa309d10d59ede6e9d4cff03a344a79d1f0f4cd0cd74997b53e0/propcache-0.5.2-cp314-cp314t-win_arm64.whl", hash = "sha256:fe67a3d11cd9b4efabfa45c3d00ffba2b26811442a73a581a94b67c2b5faccf6", size = 41140, upload-time = "2026-05-08T21:02:09.065Z" }, + { url = "https://files.pythonhosted.org/packages/3a/ed/1cdcab6ba3d6ab7feca11fc14f0eeea80755bb53ef4e892079f31b10a25f/propcache-0.5.2-py3-none-any.whl", hash = "sha256:be1ddfcbb376e3de5d2e2db1d58d6d67463e6b4f9f040c000de8e300295465fe", size = 14036, upload-time = "2026-05-08T21:02:10.673Z" }, +] + +[[package]] +name = "protobuf" +version = "6.33.5" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ba/25/7c72c307aafc96fa87062aa6291d9f7c94836e43214d43722e86037aac02/protobuf-6.33.5.tar.gz", hash = "sha256:6ddcac2a081f8b7b9642c09406bc6a4290128fce5f471cddd165960bb9119e5c", size = 444465, upload-time = "2026-01-29T21:51:33.494Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b1/79/af92d0a8369732b027e6d6084251dd8e782c685c72da161bd4a2e00fbabb/protobuf-6.33.5-cp310-abi3-win32.whl", hash = "sha256:d71b040839446bac0f4d162e758bea99c8251161dae9d0983a3b88dee345153b", size = 425769, upload-time = "2026-01-29T21:51:21.751Z" }, + { url = "https://files.pythonhosted.org/packages/55/75/bb9bc917d10e9ee13dee8607eb9ab963b7cf8be607c46e7862c748aa2af7/protobuf-6.33.5-cp310-abi3-win_amd64.whl", hash = "sha256:3093804752167bcab3998bec9f1048baae6e29505adaf1afd14a37bddede533c", size = 437118, upload-time = "2026-01-29T21:51:24.022Z" }, + { url = "https://files.pythonhosted.org/packages/a2/6b/e48dfc1191bc5b52950246275bf4089773e91cb5ba3592621723cdddca62/protobuf-6.33.5-cp39-abi3-macosx_10_9_universal2.whl", hash = "sha256:a5cb85982d95d906df1e2210e58f8e4f1e3cdc088e52c921a041f9c9a0386de5", size = 427766, upload-time = "2026-01-29T21:51:25.413Z" }, + { url = "https://files.pythonhosted.org/packages/4e/b1/c79468184310de09d75095ed1314b839eb2f72df71097db9d1404a1b2717/protobuf-6.33.5-cp39-abi3-manylinux2014_aarch64.whl", hash = "sha256:9b71e0281f36f179d00cbcb119cb19dec4d14a81393e5ea220f64b286173e190", size = 324638, upload-time = "2026-01-29T21:51:26.423Z" }, + { url = "https://files.pythonhosted.org/packages/c5/f5/65d838092fd01c44d16037953fd4c2cc851e783de9b8f02b27ec4ffd906f/protobuf-6.33.5-cp39-abi3-manylinux2014_s390x.whl", hash = "sha256:8afa18e1d6d20af15b417e728e9f60f3aa108ee76f23c3b2c07a2c3b546d3afd", size = 339411, upload-time = "2026-01-29T21:51:27.446Z" }, + { url = "https://files.pythonhosted.org/packages/9b/53/a9443aa3ca9ba8724fdfa02dd1887c1bcd8e89556b715cfbacca6b63dbec/protobuf-6.33.5-cp39-abi3-manylinux2014_x86_64.whl", hash = "sha256:cbf16ba3350fb7b889fca858fb215967792dc125b35c7976ca4818bee3521cf0", size = 323465, upload-time = "2026-01-29T21:51:28.925Z" }, + { url = "https://files.pythonhosted.org/packages/57/bf/2086963c69bdac3d7cff1cc7ff79b8ce5ea0bec6797a017e1be338a46248/protobuf-6.33.5-py3-none-any.whl", hash = "sha256:69915a973dd0f60f31a08b8318b73eab2bd6a392c79184b3612226b0a3f8ec02", size = 170687, upload-time = "2026-01-29T21:51:32.557Z" }, +] + +[[package]] +name = "proxy-tools" +version = "0.1.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/f2/cf/77d3e19b7fabd03895caca7857ef51e4c409e0ca6b37ee6e9f7daa50b642/proxy_tools-0.1.0.tar.gz", hash = "sha256:ccb3751f529c047e2d8a58440d86b205303cf0fe8146f784d1cbcd94f0a28010", size = 2978, upload-time = "2014-05-05T21:02:24.606Z" } + +[[package]] +name = "psims" +version = "1.3.5" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "lxml" }, + { name = "numpy" }, + { name = "six" }, + { name = "sqlalchemy" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/dd/f8/b0dc9e3fdf118019fd82453b6fa21280b33cbdb53fcfdd8701d937007cb3/psims-1.3.5.tar.gz", hash = "sha256:e909c65e56612000900901273c086adf5d88a4f3dd150ca7eb7b34f04b6b01e1", size = 18798760, upload-time = "2025-01-19T01:01:38.177Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/43/5f/f0e098c5730330342e25ecc5e303662834ec98f2fb9435a8eafa40b1aac0/psims-1.3.5-py3-none-any.whl", hash = "sha256:98e0a45a39c7ba4249ab7fd4506e79d89636d60dfba63838e54ee0305bedbfb6", size = 18815061, upload-time = "2025-01-19T01:01:34.306Z" }, +] + +[[package]] +name = "psm-utils" +version = "1.5.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "click" }, + { name = "lxml" }, + { name = "numpy" }, + { name = "pandas" }, + { name = "psims" }, + { name = "pyarrow" }, + { name = "pydantic" }, + { name = "pyteomics" }, + { name = "rich" }, + { name = "sqlalchemy" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/71/59/73a7b64ce948f6870e119836e1b4c6fdd8dc66860023b06eea42eba7863d/psm_utils-1.5.2.tar.gz", hash = "sha256:f49f444ad7bf6de964d2f04c114582f89e15979ff56ad813019b408cce743218", size = 80300, upload-time = "2026-02-12T12:48:15.027Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e8/11/5cfffad59b509a07a249e7b827d942ef08c5e2a32ea0ea31c24634e02838/psm_utils-1.5.2-py3-none-any.whl", hash = "sha256:abcb312d6a72ee8a9af93796431490d0380167b88f1eba57e652ea2c5e714a39", size = 94936, upload-time = "2026-02-12T12:48:13.497Z" }, +] + +[[package]] +name = "psutil" +version = "7.2.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/aa/c6/d1ddf4abb55e93cebc4f2ed8b5d6dbad109ecb8d63748dd2b20ab5e57ebe/psutil-7.2.2.tar.gz", hash = "sha256:0746f5f8d406af344fd547f1c8daa5f5c33dbc293bb8d6a16d80b4bb88f59372", size = 493740, upload-time = "2026-01-28T18:14:54.428Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/51/08/510cbdb69c25a96f4ae523f733cdc963ae654904e8db864c07585ef99875/psutil-7.2.2-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:2edccc433cbfa046b980b0df0171cd25bcaeb3a68fe9022db0979e7aa74a826b", size = 130595, upload-time = "2026-01-28T18:14:57.293Z" }, + { url = "https://files.pythonhosted.org/packages/d6/f5/97baea3fe7a5a9af7436301f85490905379b1c6f2dd51fe3ecf24b4c5fbf/psutil-7.2.2-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:e78c8603dcd9a04c7364f1a3e670cea95d51ee865e4efb3556a3a63adef958ea", size = 131082, upload-time = "2026-01-28T18:14:59.732Z" }, + { url = "https://files.pythonhosted.org/packages/37/d6/246513fbf9fa174af531f28412297dd05241d97a75911ac8febefa1a53c6/psutil-7.2.2-cp313-cp313t-manylinux2010_x86_64.manylinux_2_12_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:1a571f2330c966c62aeda00dd24620425d4b0cc86881c89861fbc04549e5dc63", size = 181476, upload-time = "2026-01-28T18:15:01.884Z" }, + { url = "https://files.pythonhosted.org/packages/b8/b5/9182c9af3836cca61696dabe4fd1304e17bc56cb62f17439e1154f225dd3/psutil-7.2.2-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:917e891983ca3c1887b4ef36447b1e0873e70c933afc831c6b6da078ba474312", size = 184062, upload-time = "2026-01-28T18:15:04.436Z" }, + { url = "https://files.pythonhosted.org/packages/16/ba/0756dca669f5a9300d0cbcbfae9a4c30e446dfc7440ffe43ded5724bfd93/psutil-7.2.2-cp313-cp313t-win_amd64.whl", hash = "sha256:ab486563df44c17f5173621c7b198955bd6b613fb87c71c161f827d3fb149a9b", size = 139893, upload-time = "2026-01-28T18:15:06.378Z" }, + { url = "https://files.pythonhosted.org/packages/1c/61/8fa0e26f33623b49949346de05ec1ddaad02ed8ba64af45f40a147dbfa97/psutil-7.2.2-cp313-cp313t-win_arm64.whl", hash = "sha256:ae0aefdd8796a7737eccea863f80f81e468a1e4cf14d926bd9b6f5f2d5f90ca9", size = 135589, upload-time = "2026-01-28T18:15:08.03Z" }, + { url = "https://files.pythonhosted.org/packages/81/69/ef179ab5ca24f32acc1dac0c247fd6a13b501fd5534dbae0e05a1c48b66d/psutil-7.2.2-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:eed63d3b4d62449571547b60578c5b2c4bcccc5387148db46e0c2313dad0ee00", size = 130664, upload-time = "2026-01-28T18:15:09.469Z" }, + { url = "https://files.pythonhosted.org/packages/7b/64/665248b557a236d3fa9efc378d60d95ef56dd0a490c2cd37dafc7660d4a9/psutil-7.2.2-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:7b6d09433a10592ce39b13d7be5a54fbac1d1228ed29abc880fb23df7cb694c9", size = 131087, upload-time = "2026-01-28T18:15:11.724Z" }, + { url = "https://files.pythonhosted.org/packages/d5/2e/e6782744700d6759ebce3043dcfa661fb61e2fb752b91cdeae9af12c2178/psutil-7.2.2-cp314-cp314t-manylinux2010_x86_64.manylinux_2_12_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:1fa4ecf83bcdf6e6c8f4449aff98eefb5d0604bf88cb883d7da3d8d2d909546a", size = 182383, upload-time = "2026-01-28T18:15:13.445Z" }, + { url = "https://files.pythonhosted.org/packages/57/49/0a41cefd10cb7505cdc04dab3eacf24c0c2cb158a998b8c7b1d27ee2c1f5/psutil-7.2.2-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e452c464a02e7dc7822a05d25db4cde564444a67e58539a00f929c51eddda0cf", size = 185210, upload-time = "2026-01-28T18:15:16.002Z" }, + { url = "https://files.pythonhosted.org/packages/dd/2c/ff9bfb544f283ba5f83ba725a3c5fec6d6b10b8f27ac1dc641c473dc390d/psutil-7.2.2-cp314-cp314t-win_amd64.whl", hash = "sha256:c7663d4e37f13e884d13994247449e9f8f574bc4655d509c3b95e9ec9e2b9dc1", size = 141228, upload-time = "2026-01-28T18:15:18.385Z" }, + { url = "https://files.pythonhosted.org/packages/f2/fc/f8d9c31db14fcec13748d373e668bc3bed94d9077dbc17fb0eebc073233c/psutil-7.2.2-cp314-cp314t-win_arm64.whl", hash = "sha256:11fe5a4f613759764e79c65cf11ebdf26e33d6dd34336f8a337aa2996d71c841", size = 136284, upload-time = "2026-01-28T18:15:19.912Z" }, + { url = "https://files.pythonhosted.org/packages/e7/36/5ee6e05c9bd427237b11b3937ad82bb8ad2752d72c6969314590dd0c2f6e/psutil-7.2.2-cp36-abi3-macosx_10_9_x86_64.whl", hash = "sha256:ed0cace939114f62738d808fdcecd4c869222507e266e574799e9c0faa17d486", size = 129090, upload-time = "2026-01-28T18:15:22.168Z" }, + { url = "https://files.pythonhosted.org/packages/80/c4/f5af4c1ca8c1eeb2e92ccca14ce8effdeec651d5ab6053c589b074eda6e1/psutil-7.2.2-cp36-abi3-macosx_11_0_arm64.whl", hash = "sha256:1a7b04c10f32cc88ab39cbf606e117fd74721c831c98a27dc04578deb0c16979", size = 129859, upload-time = "2026-01-28T18:15:23.795Z" }, + { url = "https://files.pythonhosted.org/packages/b5/70/5d8df3b09e25bce090399cf48e452d25c935ab72dad19406c77f4e828045/psutil-7.2.2-cp36-abi3-manylinux2010_x86_64.manylinux_2_12_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:076a2d2f923fd4821644f5ba89f059523da90dc9014e85f8e45a5774ca5bc6f9", size = 155560, upload-time = "2026-01-28T18:15:25.976Z" }, + { url = "https://files.pythonhosted.org/packages/63/65/37648c0c158dc222aba51c089eb3bdfa238e621674dc42d48706e639204f/psutil-7.2.2-cp36-abi3-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:b0726cecd84f9474419d67252add4ac0cd9811b04d61123054b9fb6f57df6e9e", size = 156997, upload-time = "2026-01-28T18:15:27.794Z" }, + { url = "https://files.pythonhosted.org/packages/8e/13/125093eadae863ce03c6ffdbae9929430d116a246ef69866dad94da3bfbc/psutil-7.2.2-cp36-abi3-musllinux_1_2_aarch64.whl", hash = "sha256:fd04ef36b4a6d599bbdb225dd1d3f51e00105f6d48a28f006da7f9822f2606d8", size = 148972, upload-time = "2026-01-28T18:15:29.342Z" }, + { url = "https://files.pythonhosted.org/packages/04/78/0acd37ca84ce3ddffaa92ef0f571e073faa6d8ff1f0559ab1272188ea2be/psutil-7.2.2-cp36-abi3-musllinux_1_2_x86_64.whl", hash = "sha256:b58fabe35e80b264a4e3bb23e6b96f9e45a3df7fb7eed419ac0e5947c61e47cc", size = 148266, upload-time = "2026-01-28T18:15:31.597Z" }, + { url = "https://files.pythonhosted.org/packages/b4/90/e2159492b5426be0c1fef7acba807a03511f97c5f86b3caeda6ad92351a7/psutil-7.2.2-cp37-abi3-win_amd64.whl", hash = "sha256:eb7e81434c8d223ec4a219b5fc1c47d0417b12be7ea866e24fb5ad6e84b3d988", size = 137737, upload-time = "2026-01-28T18:15:33.849Z" }, + { url = "https://files.pythonhosted.org/packages/8c/c7/7bb2e321574b10df20cbde462a94e2b71d05f9bbda251ef27d104668306a/psutil-7.2.2-cp37-abi3-win_arm64.whl", hash = "sha256:8c233660f575a5a89e6d4cb65d9f938126312bca76d8fe087b947b3a1aaac9ee", size = 134617, upload-time = "2026-01-28T18:15:36.514Z" }, +] + +[[package]] +name = "ptyprocess" +version = "0.7.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/20/e5/16ff212c1e452235a90aeb09066144d0c5a6a8c0834397e03f5224495c4e/ptyprocess-0.7.0.tar.gz", hash = "sha256:5c5d0a3b48ceee0b48485e0c26037c0acd7d29765ca3fbb5cb3831d347423220", size = 70762, upload-time = "2020-12-28T15:15:30.155Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/22/a6/858897256d0deac81a172289110f31629fc4cee19b6f01283303e18c8db3/ptyprocess-0.7.0-py2.py3-none-any.whl", hash = "sha256:4b41f3967fce3af57cc7e94b888626c18bf37a083e3651ca8feeb66d492fef35", size = 13993, upload-time = "2020-12-28T15:15:28.35Z" }, +] + +[[package]] +name = "pure-eval" +version = "0.2.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/cd/05/0a34433a064256a578f1783a10da6df098ceaa4a57bbeaa96a6c0352786b/pure_eval-0.2.3.tar.gz", hash = "sha256:5f4e983f40564c576c7c8635ae88db5956bb2229d7e9237d03b3c0b0190eaf42", size = 19752, upload-time = "2024-07-21T12:58:21.801Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/8e/37/efad0257dc6e593a18957422533ff0f87ede7c9c6ea010a2177d738fb82f/pure_eval-0.2.3-py3-none-any.whl", hash = "sha256:1db8e35b67b3d218d818ae653e27f06c3aa420901fa7b081ca98cbedc874e0d0", size = 11842, upload-time = "2024-07-21T12:58:20.04Z" }, +] + +[[package]] +name = "pyarrow" +version = "23.0.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/88/22/134986a4cc224d593c1afde5494d18ff629393d74cc2eddb176669f234a4/pyarrow-23.0.1.tar.gz", hash = "sha256:b8c5873e33440b2bc2f4a79d2b47017a89c5a24116c055625e6f2ee50523f019", size = 1167336, upload-time = "2026-02-16T10:14:12.39Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b0/41/8e6b6ef7e225d4ceead8459427a52afdc23379768f54dd3566014d7618c1/pyarrow-23.0.1-cp311-cp311-macosx_12_0_arm64.whl", hash = "sha256:6f0147ee9e0386f519c952cc670eb4a8b05caa594eeffe01af0e25f699e4e9bb", size = 34302230, upload-time = "2026-02-16T10:09:03.859Z" }, + { url = "https://files.pythonhosted.org/packages/bf/4a/1472c00392f521fea03ae93408bf445cc7bfa1ab81683faf9bc188e36629/pyarrow-23.0.1-cp311-cp311-macosx_12_0_x86_64.whl", hash = "sha256:0ae6e17c828455b6265d590100c295193f93cc5675eb0af59e49dbd00d2de350", size = 35850050, upload-time = "2026-02-16T10:09:11.877Z" }, + { url = "https://files.pythonhosted.org/packages/0c/b2/bd1f2f05ded56af7f54d702c8364c9c43cd6abb91b0e9933f3d77b4f4132/pyarrow-23.0.1-cp311-cp311-manylinux_2_28_aarch64.whl", hash = "sha256:fed7020203e9ef273360b9e45be52a2a47d3103caf156a30ace5247ffb51bdbd", size = 44491918, upload-time = "2026-02-16T10:09:18.144Z" }, + { url = "https://files.pythonhosted.org/packages/0b/62/96459ef5b67957eac38a90f541d1c28833d1b367f014a482cb63f3b7cd2d/pyarrow-23.0.1-cp311-cp311-manylinux_2_28_x86_64.whl", hash = "sha256:26d50dee49d741ac0e82185033488d28d35be4d763ae6f321f97d1140eb7a0e9", size = 47562811, upload-time = "2026-02-16T10:09:25.792Z" }, + { url = "https://files.pythonhosted.org/packages/7d/94/1170e235add1f5f45a954e26cd0e906e7e74e23392dcb560de471f7366ec/pyarrow-23.0.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:3c30143b17161310f151f4a2bcfe41b5ff744238c1039338779424e38579d701", size = 48183766, upload-time = "2026-02-16T10:09:34.645Z" }, + { url = "https://files.pythonhosted.org/packages/0e/2d/39a42af4570377b99774cdb47f63ee6c7da7616bd55b3d5001aa18edfe4f/pyarrow-23.0.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:db2190fa79c80a23fdd29fef4b8992893f024ae7c17d2f5f4db7171fa30c2c78", size = 50607669, upload-time = "2026-02-16T10:09:44.153Z" }, + { url = "https://files.pythonhosted.org/packages/00/ca/db94101c187f3df742133ac837e93b1f269ebdac49427f8310ee40b6a58f/pyarrow-23.0.1-cp311-cp311-win_amd64.whl", hash = "sha256:f00f993a8179e0e1c9713bcc0baf6d6c01326a406a9c23495ec1ba9c9ebf2919", size = 27527698, upload-time = "2026-02-16T10:09:50.263Z" }, + { url = "https://files.pythonhosted.org/packages/9a/4b/4166bb5abbfe6f750fc60ad337c43ecf61340fa52ab386da6e8dbf9e63c4/pyarrow-23.0.1-cp312-cp312-macosx_12_0_arm64.whl", hash = "sha256:f4b0dbfa124c0bb161f8b5ebb40f1a680b70279aa0c9901d44a2b5a20806039f", size = 34214575, upload-time = "2026-02-16T10:09:56.225Z" }, + { url = "https://files.pythonhosted.org/packages/e1/da/3f941e3734ac8088ea588b53e860baeddac8323ea40ce22e3d0baa865cc9/pyarrow-23.0.1-cp312-cp312-macosx_12_0_x86_64.whl", hash = "sha256:7707d2b6673f7de054e2e83d59f9e805939038eebe1763fe811ee8fa5c0cd1a7", size = 35832540, upload-time = "2026-02-16T10:10:03.428Z" }, + { url = "https://files.pythonhosted.org/packages/88/7c/3d841c366620e906d54430817531b877ba646310296df42ef697308c2705/pyarrow-23.0.1-cp312-cp312-manylinux_2_28_aarch64.whl", hash = "sha256:86ff03fb9f1a320266e0de855dee4b17da6794c595d207f89bba40d16b5c78b9", size = 44470940, upload-time = "2026-02-16T10:10:10.704Z" }, + { url = "https://files.pythonhosted.org/packages/2c/a5/da83046273d990f256cb79796a190bbf7ec999269705ddc609403f8c6b06/pyarrow-23.0.1-cp312-cp312-manylinux_2_28_x86_64.whl", hash = "sha256:813d99f31275919c383aab17f0f455a04f5a429c261cc411b1e9a8f5e4aaaa05", size = 47586063, upload-time = "2026-02-16T10:10:17.95Z" }, + { url = "https://files.pythonhosted.org/packages/5b/3c/b7d2ebcff47a514f47f9da1e74b7949138c58cfeb108cdd4ee62f43f0cf3/pyarrow-23.0.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:bf5842f960cddd2ef757d486041d57c96483efc295a8c4a0e20e704cbbf39c67", size = 48173045, upload-time = "2026-02-16T10:10:25.363Z" }, + { url = "https://files.pythonhosted.org/packages/43/b2/b40961262213beaba6acfc88698eb773dfce32ecdf34d19291db94c2bd73/pyarrow-23.0.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:564baf97c858ecc03ec01a41062e8f4698abc3e6e2acd79c01c2e97880a19730", size = 50621741, upload-time = "2026-02-16T10:10:33.477Z" }, + { url = "https://files.pythonhosted.org/packages/f6/70/1fdda42d65b28b078e93d75d371b2185a61da89dda4def8ba6ba41ebdeb4/pyarrow-23.0.1-cp312-cp312-win_amd64.whl", hash = "sha256:07deae7783782ac7250989a7b2ecde9b3c343a643f82e8a4df03d93b633006f0", size = 27620678, upload-time = "2026-02-16T10:10:39.31Z" }, + { url = "https://files.pythonhosted.org/packages/47/10/2cbe4c6f0fb83d2de37249567373d64327a5e4d8db72f486db42875b08f6/pyarrow-23.0.1-cp313-cp313-macosx_12_0_arm64.whl", hash = "sha256:6b8fda694640b00e8af3c824f99f789e836720aa8c9379fb435d4c4953a756b8", size = 34210066, upload-time = "2026-02-16T10:10:45.487Z" }, + { url = "https://files.pythonhosted.org/packages/cb/4f/679fa7e84dadbaca7a65f7cdba8d6c83febbd93ca12fa4adf40ba3b6362b/pyarrow-23.0.1-cp313-cp313-macosx_12_0_x86_64.whl", hash = "sha256:8ff51b1addc469b9444b7c6f3548e19dc931b172ab234e995a60aea9f6e6025f", size = 35825526, upload-time = "2026-02-16T10:10:52.266Z" }, + { url = "https://files.pythonhosted.org/packages/f9/63/d2747d930882c9d661e9398eefc54f15696547b8983aaaf11d4a2e8b5426/pyarrow-23.0.1-cp313-cp313-manylinux_2_28_aarch64.whl", hash = "sha256:71c5be5cbf1e1cb6169d2a0980850bccb558ddc9b747b6206435313c47c37677", size = 44473279, upload-time = "2026-02-16T10:11:01.557Z" }, + { url = "https://files.pythonhosted.org/packages/b3/93/10a48b5e238de6d562a411af6467e71e7aedbc9b87f8d3a35f1560ae30fb/pyarrow-23.0.1-cp313-cp313-manylinux_2_28_x86_64.whl", hash = "sha256:9b6f4f17b43bc39d56fec96e53fe89d94bac3eb134137964371b45352d40d0c2", size = 47585798, upload-time = "2026-02-16T10:11:09.401Z" }, + { url = "https://files.pythonhosted.org/packages/5c/20/476943001c54ef078dbf9542280e22741219a184a0632862bca4feccd666/pyarrow-23.0.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:9fc13fc6c403d1337acab46a2c4346ca6c9dec5780c3c697cf8abfd5e19b6b37", size = 48179446, upload-time = "2026-02-16T10:11:17.781Z" }, + { url = "https://files.pythonhosted.org/packages/4b/b6/5dd0c47b335fcd8edba9bfab78ad961bd0fd55ebe53468cc393f45e0be60/pyarrow-23.0.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:5c16ed4f53247fa3ffb12a14d236de4213a4415d127fe9cebed33d51671113e2", size = 50623972, upload-time = "2026-02-16T10:11:26.185Z" }, + { url = "https://files.pythonhosted.org/packages/d5/09/a532297c9591a727d67760e2e756b83905dd89adb365a7f6e9c72578bcc1/pyarrow-23.0.1-cp313-cp313-win_amd64.whl", hash = "sha256:cecfb12ef629cf6be0b1887f9f86463b0dd3dc3195ae6224e74006be4736035a", size = 27540749, upload-time = "2026-02-16T10:12:23.297Z" }, + { url = "https://files.pythonhosted.org/packages/a5/8e/38749c4b1303e6ae76b3c80618f84861ae0c55dd3c2273842ea6f8258233/pyarrow-23.0.1-cp313-cp313t-macosx_12_0_arm64.whl", hash = "sha256:29f7f7419a0e30264ea261fdc0e5fe63ce5a6095003db2945d7cd78df391a7e1", size = 34471544, upload-time = "2026-02-16T10:11:32.535Z" }, + { url = "https://files.pythonhosted.org/packages/a3/73/f237b2bc8c669212f842bcfd842b04fc8d936bfc9d471630569132dc920d/pyarrow-23.0.1-cp313-cp313t-macosx_12_0_x86_64.whl", hash = "sha256:33d648dc25b51fd8055c19e4261e813dfc4d2427f068bcecc8b53d01b81b0500", size = 35949911, upload-time = "2026-02-16T10:11:39.813Z" }, + { url = "https://files.pythonhosted.org/packages/0c/86/b912195eee0903b5611bf596833def7d146ab2d301afeb4b722c57ffc966/pyarrow-23.0.1-cp313-cp313t-manylinux_2_28_aarch64.whl", hash = "sha256:cd395abf8f91c673dd3589cadc8cc1ee4e8674fa61b2e923c8dd215d9c7d1f41", size = 44520337, upload-time = "2026-02-16T10:11:47.764Z" }, + { url = "https://files.pythonhosted.org/packages/69/c2/f2a717fb824f62d0be952ea724b4f6f9372a17eed6f704b5c9526f12f2f1/pyarrow-23.0.1-cp313-cp313t-manylinux_2_28_x86_64.whl", hash = "sha256:00be9576d970c31defb5c32eb72ef585bf600ef6d0a82d5eccaae96639cf9d07", size = 47548944, upload-time = "2026-02-16T10:11:56.607Z" }, + { url = "https://files.pythonhosted.org/packages/84/a7/90007d476b9f0dc308e3bc57b832d004f848fd6c0da601375d20d92d1519/pyarrow-23.0.1-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:c2139549494445609f35a5cda4eb94e2c9e4d704ce60a095b342f82460c73a83", size = 48236269, upload-time = "2026-02-16T10:12:04.47Z" }, + { url = "https://files.pythonhosted.org/packages/b0/3f/b16fab3e77709856eb6ac328ce35f57a6d4a18462c7ca5186ef31b45e0e0/pyarrow-23.0.1-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:7044b442f184d84e2351e5084600f0d7343d6117aabcbc1ac78eb1ae11eb4125", size = 50604794, upload-time = "2026-02-16T10:12:11.797Z" }, + { url = "https://files.pythonhosted.org/packages/e9/a1/22df0620a9fac31d68397a75465c344e83c3dfe521f7612aea33e27ab6c0/pyarrow-23.0.1-cp313-cp313t-win_amd64.whl", hash = "sha256:a35581e856a2fafa12f3f54fce4331862b1cfb0bef5758347a858a4aa9d6bae8", size = 27660642, upload-time = "2026-02-16T10:12:17.746Z" }, + { url = "https://files.pythonhosted.org/packages/8d/1b/6da9a89583ce7b23ac611f183ae4843cd3a6cf54f079549b0e8c14031e73/pyarrow-23.0.1-cp314-cp314-macosx_12_0_arm64.whl", hash = "sha256:5df1161da23636a70838099d4aaa65142777185cc0cdba4037a18cee7d8db9ca", size = 34238755, upload-time = "2026-02-16T10:12:32.819Z" }, + { url = "https://files.pythonhosted.org/packages/ae/b5/d58a241fbe324dbaeb8df07be6af8752c846192d78d2272e551098f74e88/pyarrow-23.0.1-cp314-cp314-macosx_12_0_x86_64.whl", hash = "sha256:fa8e51cb04b9f8c9c5ace6bab63af9a1f88d35c0d6cbf53e8c17c098552285e1", size = 35847826, upload-time = "2026-02-16T10:12:38.949Z" }, + { url = "https://files.pythonhosted.org/packages/54/a5/8cbc83f04aba433ca7b331b38f39e000efd9f0c7ce47128670e737542996/pyarrow-23.0.1-cp314-cp314-manylinux_2_28_aarch64.whl", hash = "sha256:0b95a3994f015be13c63148fef8832e8a23938128c185ee951c98908a696e0eb", size = 44536859, upload-time = "2026-02-16T10:12:45.467Z" }, + { url = "https://files.pythonhosted.org/packages/36/2e/c0f017c405fcdc252dbccafbe05e36b0d0eb1ea9a958f081e01c6972927f/pyarrow-23.0.1-cp314-cp314-manylinux_2_28_x86_64.whl", hash = "sha256:4982d71350b1a6e5cfe1af742c53dfb759b11ce14141870d05d9e540d13bc5d1", size = 47614443, upload-time = "2026-02-16T10:12:55.525Z" }, + { url = "https://files.pythonhosted.org/packages/af/6b/2314a78057912f5627afa13ba43809d9d653e6630859618b0fd81a4e0759/pyarrow-23.0.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:c250248f1fe266db627921c89b47b7c06fee0489ad95b04d50353537d74d6886", size = 48232991, upload-time = "2026-02-16T10:13:04.729Z" }, + { url = "https://files.pythonhosted.org/packages/40/f2/1bcb1d3be3460832ef3370d621142216e15a2c7c62602a4ea19ec240dd64/pyarrow-23.0.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:5f4763b83c11c16e5f4c15601ba6dfa849e20723b46aa2617cb4bffe8768479f", size = 50645077, upload-time = "2026-02-16T10:13:14.147Z" }, + { url = "https://files.pythonhosted.org/packages/eb/3f/b1da7b61cd66566a4d4c8383d376c606d1c34a906c3f1cb35c479f59d1aa/pyarrow-23.0.1-cp314-cp314-win_amd64.whl", hash = "sha256:3a4c85ef66c134161987c17b147d6bffdca4566f9a4c1d81a0a01cdf08414ea5", size = 28234271, upload-time = "2026-02-16T10:14:09.397Z" }, + { url = "https://files.pythonhosted.org/packages/b5/78/07f67434e910a0f7323269be7bfbf58699bd0c1d080b18a1ab49ba943fe8/pyarrow-23.0.1-cp314-cp314t-macosx_12_0_arm64.whl", hash = "sha256:17cd28e906c18af486a499422740298c52d7c6795344ea5002a7720b4eadf16d", size = 34488692, upload-time = "2026-02-16T10:13:21.541Z" }, + { url = "https://files.pythonhosted.org/packages/50/76/34cf7ae93ece1f740a04910d9f7e80ba166b9b4ab9596a953e9e62b90fe1/pyarrow-23.0.1-cp314-cp314t-macosx_12_0_x86_64.whl", hash = "sha256:76e823d0e86b4fb5e1cf4a58d293036e678b5a4b03539be933d3b31f9406859f", size = 35964383, upload-time = "2026-02-16T10:13:28.63Z" }, + { url = "https://files.pythonhosted.org/packages/46/90/459b827238936d4244214be7c684e1b366a63f8c78c380807ae25ed92199/pyarrow-23.0.1-cp314-cp314t-manylinux_2_28_aarch64.whl", hash = "sha256:a62e1899e3078bf65943078b3ad2a6ddcacf2373bc06379aac61b1e548a75814", size = 44538119, upload-time = "2026-02-16T10:13:35.506Z" }, + { url = "https://files.pythonhosted.org/packages/28/a1/93a71ae5881e99d1f9de1d4554a87be37da11cd6b152239fb5bd924fdc64/pyarrow-23.0.1-cp314-cp314t-manylinux_2_28_x86_64.whl", hash = "sha256:df088e8f640c9fae3b1f495b3c64755c4e719091caf250f3a74d095ddf3c836d", size = 47571199, upload-time = "2026-02-16T10:13:42.504Z" }, + { url = "https://files.pythonhosted.org/packages/88/a3/d2c462d4ef313521eaf2eff04d204ac60775263f1fb08c374b543f79f610/pyarrow-23.0.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:46718a220d64677c93bc243af1d44b55998255427588e400677d7192671845c7", size = 48259435, upload-time = "2026-02-16T10:13:49.226Z" }, + { url = "https://files.pythonhosted.org/packages/cc/f1/11a544b8c3d38a759eb3fbb022039117fd633e9a7b19e4841cc3da091915/pyarrow-23.0.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:a09f3876e87f48bc2f13583ab551f0379e5dfb83210391e68ace404181a20690", size = 50629149, upload-time = "2026-02-16T10:13:57.238Z" }, + { url = "https://files.pythonhosted.org/packages/50/f2/c0e76a0b451ffdf0cf788932e182758eb7558953f4f27f1aff8e2518b653/pyarrow-23.0.1-cp314-cp314t-win_amd64.whl", hash = "sha256:527e8d899f14bd15b740cd5a54ad56b7f98044955373a17179d5956ddb93d9ce", size = 28365807, upload-time = "2026-02-16T10:14:03.892Z" }, +] + +[[package]] +name = "pycparser" +version = "3.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/1b/7d/92392ff7815c21062bea51aa7b87d45576f649f16458d78b7cf94b9ab2e6/pycparser-3.0.tar.gz", hash = "sha256:600f49d217304a5902ac3c37e1281c9fe94e4d0489de643a9504c5cdfdfc6b29", size = 103492, upload-time = "2026-01-21T14:26:51.89Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0c/c3/44f3fbbfa403ea2a7c779186dc20772604442dde72947e7d01069cbe98e3/pycparser-3.0-py3-none-any.whl", hash = "sha256:b727414169a36b7d524c1c3e31839a521725078d7b2ff038656844266160a992", size = 48172, upload-time = "2026-01-21T14:26:50.693Z" }, +] + +[[package]] +name = "pydantic" +version = "2.12.5" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "annotated-types" }, + { name = "pydantic-core" }, + { name = "typing-extensions" }, + { name = "typing-inspection" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/69/44/36f1a6e523abc58ae5f928898e4aca2e0ea509b5aa6f6f392a5d882be928/pydantic-2.12.5.tar.gz", hash = "sha256:4d351024c75c0f085a9febbb665ce8c0c6ec5d30e903bdb6394b7ede26aebb49", size = 821591, upload-time = "2025-11-26T15:11:46.471Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/5a/87/b70ad306ebb6f9b585f114d0ac2137d792b48be34d732d60e597c2f8465a/pydantic-2.12.5-py3-none-any.whl", hash = "sha256:e561593fccf61e8a20fc46dfc2dfe075b8be7d0188df33f221ad1f0139180f9d", size = 463580, upload-time = "2025-11-26T15:11:44.605Z" }, +] + +[[package]] +name = "pydantic-core" +version = "2.41.5" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "typing-extensions" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/71/70/23b021c950c2addd24ec408e9ab05d59b035b39d97cdc1130e1bce647bb6/pydantic_core-2.41.5.tar.gz", hash = "sha256:08daa51ea16ad373ffd5e7606252cc32f07bc72b28284b6bc9c6df804816476e", size = 460952, upload-time = "2025-11-04T13:43:49.098Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e8/72/74a989dd9f2084b3d9530b0915fdda64ac48831c30dbf7c72a41a5232db8/pydantic_core-2.41.5-cp311-cp311-macosx_10_12_x86_64.whl", hash = "sha256:a3a52f6156e73e7ccb0f8cced536adccb7042be67cb45f9562e12b319c119da6", size = 2105873, upload-time = "2025-11-04T13:39:31.373Z" }, + { url = "https://files.pythonhosted.org/packages/12/44/37e403fd9455708b3b942949e1d7febc02167662bf1a7da5b78ee1ea2842/pydantic_core-2.41.5-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:7f3bf998340c6d4b0c9a2f02d6a400e51f123b59565d74dc60d252ce888c260b", size = 1899826, upload-time = "2025-11-04T13:39:32.897Z" }, + { url = "https://files.pythonhosted.org/packages/33/7f/1d5cab3ccf44c1935a359d51a8a2a9e1a654b744b5e7f80d41b88d501eec/pydantic_core-2.41.5-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:378bec5c66998815d224c9ca994f1e14c0c21cb95d2f52b6021cc0b2a58f2a5a", size = 1917869, upload-time = "2025-11-04T13:39:34.469Z" }, + { url = "https://files.pythonhosted.org/packages/6e/6a/30d94a9674a7fe4f4744052ed6c5e083424510be1e93da5bc47569d11810/pydantic_core-2.41.5-cp311-cp311-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:e7b576130c69225432866fe2f4a469a85a54ade141d96fd396dffcf607b558f8", size = 2063890, upload-time = "2025-11-04T13:39:36.053Z" }, + { url = "https://files.pythonhosted.org/packages/50/be/76e5d46203fcb2750e542f32e6c371ffa9b8ad17364cf94bb0818dbfb50c/pydantic_core-2.41.5-cp311-cp311-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:6cb58b9c66f7e4179a2d5e0f849c48eff5c1fca560994d6eb6543abf955a149e", size = 2229740, upload-time = "2025-11-04T13:39:37.753Z" }, + { url = "https://files.pythonhosted.org/packages/d3/ee/fed784df0144793489f87db310a6bbf8118d7b630ed07aa180d6067e653a/pydantic_core-2.41.5-cp311-cp311-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:88942d3a3dff3afc8288c21e565e476fc278902ae4d6d134f1eeda118cc830b1", size = 2350021, upload-time = "2025-11-04T13:39:40.94Z" }, + { url = "https://files.pythonhosted.org/packages/c8/be/8fed28dd0a180dca19e72c233cbf58efa36df055e5b9d90d64fd1740b828/pydantic_core-2.41.5-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:f31d95a179f8d64d90f6831d71fa93290893a33148d890ba15de25642c5d075b", size = 2066378, upload-time = "2025-11-04T13:39:42.523Z" }, + { url = "https://files.pythonhosted.org/packages/b0/3b/698cf8ae1d536a010e05121b4958b1257f0b5522085e335360e53a6b1c8b/pydantic_core-2.41.5-cp311-cp311-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:c1df3d34aced70add6f867a8cf413e299177e0c22660cc767218373d0779487b", size = 2175761, upload-time = "2025-11-04T13:39:44.553Z" }, + { url = "https://files.pythonhosted.org/packages/b8/ba/15d537423939553116dea94ce02f9c31be0fa9d0b806d427e0308ec17145/pydantic_core-2.41.5-cp311-cp311-musllinux_1_1_aarch64.whl", hash = "sha256:4009935984bd36bd2c774e13f9a09563ce8de4abaa7226f5108262fa3e637284", size = 2146303, upload-time = "2025-11-04T13:39:46.238Z" }, + { url = "https://files.pythonhosted.org/packages/58/7f/0de669bf37d206723795f9c90c82966726a2ab06c336deba4735b55af431/pydantic_core-2.41.5-cp311-cp311-musllinux_1_1_armv7l.whl", hash = "sha256:34a64bc3441dc1213096a20fe27e8e128bd3ff89921706e83c0b1ac971276594", size = 2340355, upload-time = "2025-11-04T13:39:48.002Z" }, + { url = "https://files.pythonhosted.org/packages/e5/de/e7482c435b83d7e3c3ee5ee4451f6e8973cff0eb6007d2872ce6383f6398/pydantic_core-2.41.5-cp311-cp311-musllinux_1_1_x86_64.whl", hash = "sha256:c9e19dd6e28fdcaa5a1de679aec4141f691023916427ef9bae8584f9c2fb3b0e", size = 2319875, upload-time = "2025-11-04T13:39:49.705Z" }, + { url = "https://files.pythonhosted.org/packages/fe/e6/8c9e81bb6dd7560e33b9053351c29f30c8194b72f2d6932888581f503482/pydantic_core-2.41.5-cp311-cp311-win32.whl", hash = "sha256:2c010c6ded393148374c0f6f0bf89d206bf3217f201faa0635dcd56bd1520f6b", size = 1987549, upload-time = "2025-11-04T13:39:51.842Z" }, + { url = "https://files.pythonhosted.org/packages/11/66/f14d1d978ea94d1bc21fc98fcf570f9542fe55bfcc40269d4e1a21c19bf7/pydantic_core-2.41.5-cp311-cp311-win_amd64.whl", hash = "sha256:76ee27c6e9c7f16f47db7a94157112a2f3a00e958bc626e2f4ee8bec5c328fbe", size = 2011305, upload-time = "2025-11-04T13:39:53.485Z" }, + { url = "https://files.pythonhosted.org/packages/56/d8/0e271434e8efd03186c5386671328154ee349ff0354d83c74f5caaf096ed/pydantic_core-2.41.5-cp311-cp311-win_arm64.whl", hash = "sha256:4bc36bbc0b7584de96561184ad7f012478987882ebf9f9c389b23f432ea3d90f", size = 1972902, upload-time = "2025-11-04T13:39:56.488Z" }, + { url = "https://files.pythonhosted.org/packages/5f/5d/5f6c63eebb5afee93bcaae4ce9a898f3373ca23df3ccaef086d0233a35a7/pydantic_core-2.41.5-cp312-cp312-macosx_10_12_x86_64.whl", hash = "sha256:f41a7489d32336dbf2199c8c0a215390a751c5b014c2c1c5366e817202e9cdf7", size = 2110990, upload-time = "2025-11-04T13:39:58.079Z" }, + { url = "https://files.pythonhosted.org/packages/aa/32/9c2e8ccb57c01111e0fd091f236c7b371c1bccea0fa85247ac55b1e2b6b6/pydantic_core-2.41.5-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:070259a8818988b9a84a449a2a7337c7f430a22acc0859c6b110aa7212a6d9c0", size = 1896003, upload-time = "2025-11-04T13:39:59.956Z" }, + { url = "https://files.pythonhosted.org/packages/68/b8/a01b53cb0e59139fbc9e4fda3e9724ede8de279097179be4ff31f1abb65a/pydantic_core-2.41.5-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:e96cea19e34778f8d59fe40775a7a574d95816eb150850a85a7a4c8f4b94ac69", size = 1919200, upload-time = "2025-11-04T13:40:02.241Z" }, + { url = "https://files.pythonhosted.org/packages/38/de/8c36b5198a29bdaade07b5985e80a233a5ac27137846f3bc2d3b40a47360/pydantic_core-2.41.5-cp312-cp312-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:ed2e99c456e3fadd05c991f8f437ef902e00eedf34320ba2b0842bd1c3ca3a75", size = 2052578, upload-time = "2025-11-04T13:40:04.401Z" }, + { url = "https://files.pythonhosted.org/packages/00/b5/0e8e4b5b081eac6cb3dbb7e60a65907549a1ce035a724368c330112adfdd/pydantic_core-2.41.5-cp312-cp312-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:65840751b72fbfd82c3c640cff9284545342a4f1eb1586ad0636955b261b0b05", size = 2208504, upload-time = "2025-11-04T13:40:06.072Z" }, + { url = "https://files.pythonhosted.org/packages/77/56/87a61aad59c7c5b9dc8caad5a41a5545cba3810c3e828708b3d7404f6cef/pydantic_core-2.41.5-cp312-cp312-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:e536c98a7626a98feb2d3eaf75944ef6f3dbee447e1f841eae16f2f0a72d8ddc", size = 2335816, upload-time = "2025-11-04T13:40:07.835Z" }, + { url = "https://files.pythonhosted.org/packages/0d/76/941cc9f73529988688a665a5c0ecff1112b3d95ab48f81db5f7606f522d3/pydantic_core-2.41.5-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:eceb81a8d74f9267ef4081e246ffd6d129da5d87e37a77c9bde550cb04870c1c", size = 2075366, upload-time = "2025-11-04T13:40:09.804Z" }, + { url = "https://files.pythonhosted.org/packages/d3/43/ebef01f69baa07a482844faaa0a591bad1ef129253ffd0cdaa9d8a7f72d3/pydantic_core-2.41.5-cp312-cp312-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:d38548150c39b74aeeb0ce8ee1d8e82696f4a4e16ddc6de7b1d8823f7de4b9b5", size = 2171698, upload-time = "2025-11-04T13:40:12.004Z" }, + { url = "https://files.pythonhosted.org/packages/b1/87/41f3202e4193e3bacfc2c065fab7706ebe81af46a83d3e27605029c1f5a6/pydantic_core-2.41.5-cp312-cp312-musllinux_1_1_aarch64.whl", hash = "sha256:c23e27686783f60290e36827f9c626e63154b82b116d7fe9adba1fda36da706c", size = 2132603, upload-time = "2025-11-04T13:40:13.868Z" }, + { url = "https://files.pythonhosted.org/packages/49/7d/4c00df99cb12070b6bccdef4a195255e6020a550d572768d92cc54dba91a/pydantic_core-2.41.5-cp312-cp312-musllinux_1_1_armv7l.whl", hash = "sha256:482c982f814460eabe1d3bb0adfdc583387bd4691ef00b90575ca0d2b6fe2294", size = 2329591, upload-time = "2025-11-04T13:40:15.672Z" }, + { url = "https://files.pythonhosted.org/packages/cc/6a/ebf4b1d65d458f3cda6a7335d141305dfa19bdc61140a884d165a8a1bbc7/pydantic_core-2.41.5-cp312-cp312-musllinux_1_1_x86_64.whl", hash = "sha256:bfea2a5f0b4d8d43adf9d7b8bf019fb46fdd10a2e5cde477fbcb9d1fa08c68e1", size = 2319068, upload-time = "2025-11-04T13:40:17.532Z" }, + { url = "https://files.pythonhosted.org/packages/49/3b/774f2b5cd4192d5ab75870ce4381fd89cf218af999515baf07e7206753f0/pydantic_core-2.41.5-cp312-cp312-win32.whl", hash = "sha256:b74557b16e390ec12dca509bce9264c3bbd128f8a2c376eaa68003d7f327276d", size = 1985908, upload-time = "2025-11-04T13:40:19.309Z" }, + { url = "https://files.pythonhosted.org/packages/86/45/00173a033c801cacf67c190fef088789394feaf88a98a7035b0e40d53dc9/pydantic_core-2.41.5-cp312-cp312-win_amd64.whl", hash = "sha256:1962293292865bca8e54702b08a4f26da73adc83dd1fcf26fbc875b35d81c815", size = 2020145, upload-time = "2025-11-04T13:40:21.548Z" }, + { url = "https://files.pythonhosted.org/packages/f9/22/91fbc821fa6d261b376a3f73809f907cec5ca6025642c463d3488aad22fb/pydantic_core-2.41.5-cp312-cp312-win_arm64.whl", hash = "sha256:1746d4a3d9a794cacae06a5eaaccb4b8643a131d45fbc9af23e353dc0a5ba5c3", size = 1976179, upload-time = "2025-11-04T13:40:23.393Z" }, + { url = "https://files.pythonhosted.org/packages/87/06/8806241ff1f70d9939f9af039c6c35f2360cf16e93c2ca76f184e76b1564/pydantic_core-2.41.5-cp313-cp313-macosx_10_12_x86_64.whl", hash = "sha256:941103c9be18ac8daf7b7adca8228f8ed6bb7a1849020f643b3a14d15b1924d9", size = 2120403, upload-time = "2025-11-04T13:40:25.248Z" }, + { url = "https://files.pythonhosted.org/packages/94/02/abfa0e0bda67faa65fef1c84971c7e45928e108fe24333c81f3bfe35d5f5/pydantic_core-2.41.5-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:112e305c3314f40c93998e567879e887a3160bb8689ef3d2c04b6cc62c33ac34", size = 1896206, upload-time = "2025-11-04T13:40:27.099Z" }, + { url = "https://files.pythonhosted.org/packages/15/df/a4c740c0943e93e6500f9eb23f4ca7ec9bf71b19e608ae5b579678c8d02f/pydantic_core-2.41.5-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:0cbaad15cb0c90aa221d43c00e77bb33c93e8d36e0bf74760cd00e732d10a6a0", size = 1919307, upload-time = "2025-11-04T13:40:29.806Z" }, + { url = "https://files.pythonhosted.org/packages/9a/e3/6324802931ae1d123528988e0e86587c2072ac2e5394b4bc2bc34b61ff6e/pydantic_core-2.41.5-cp313-cp313-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:03ca43e12fab6023fc79d28ca6b39b05f794ad08ec2feccc59a339b02f2b3d33", size = 2063258, upload-time = "2025-11-04T13:40:33.544Z" }, + { url = "https://files.pythonhosted.org/packages/c9/d4/2230d7151d4957dd79c3044ea26346c148c98fbf0ee6ebd41056f2d62ab5/pydantic_core-2.41.5-cp313-cp313-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:dc799088c08fa04e43144b164feb0c13f9a0bc40503f8df3e9fde58a3c0c101e", size = 2214917, upload-time = "2025-11-04T13:40:35.479Z" }, + { url = "https://files.pythonhosted.org/packages/e6/9f/eaac5df17a3672fef0081b6c1bb0b82b33ee89aa5cec0d7b05f52fd4a1fa/pydantic_core-2.41.5-cp313-cp313-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:97aeba56665b4c3235a0e52b2c2f5ae9cd071b8a8310ad27bddb3f7fb30e9aa2", size = 2332186, upload-time = "2025-11-04T13:40:37.436Z" }, + { url = "https://files.pythonhosted.org/packages/cf/4e/35a80cae583a37cf15604b44240e45c05e04e86f9cfd766623149297e971/pydantic_core-2.41.5-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:406bf18d345822d6c21366031003612b9c77b3e29ffdb0f612367352aab7d586", size = 2073164, upload-time = "2025-11-04T13:40:40.289Z" }, + { url = "https://files.pythonhosted.org/packages/bf/e3/f6e262673c6140dd3305d144d032f7bd5f7497d3871c1428521f19f9efa2/pydantic_core-2.41.5-cp313-cp313-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:b93590ae81f7010dbe380cdeab6f515902ebcbefe0b9327cc4804d74e93ae69d", size = 2179146, upload-time = "2025-11-04T13:40:42.809Z" }, + { url = "https://files.pythonhosted.org/packages/75/c7/20bd7fc05f0c6ea2056a4565c6f36f8968c0924f19b7d97bbfea55780e73/pydantic_core-2.41.5-cp313-cp313-musllinux_1_1_aarch64.whl", hash = "sha256:01a3d0ab748ee531f4ea6c3e48ad9dac84ddba4b0d82291f87248f2f9de8d740", size = 2137788, upload-time = "2025-11-04T13:40:44.752Z" }, + { url = "https://files.pythonhosted.org/packages/3a/8d/34318ef985c45196e004bc46c6eab2eda437e744c124ef0dbe1ff2c9d06b/pydantic_core-2.41.5-cp313-cp313-musllinux_1_1_armv7l.whl", hash = "sha256:6561e94ba9dacc9c61bce40e2d6bdc3bfaa0259d3ff36ace3b1e6901936d2e3e", size = 2340133, upload-time = "2025-11-04T13:40:46.66Z" }, + { url = "https://files.pythonhosted.org/packages/9c/59/013626bf8c78a5a5d9350d12e7697d3d4de951a75565496abd40ccd46bee/pydantic_core-2.41.5-cp313-cp313-musllinux_1_1_x86_64.whl", hash = "sha256:915c3d10f81bec3a74fbd4faebe8391013ba61e5a1a8d48c4455b923bdda7858", size = 2324852, upload-time = "2025-11-04T13:40:48.575Z" }, + { url = "https://files.pythonhosted.org/packages/1a/d9/c248c103856f807ef70c18a4f986693a46a8ffe1602e5d361485da502d20/pydantic_core-2.41.5-cp313-cp313-win32.whl", hash = "sha256:650ae77860b45cfa6e2cdafc42618ceafab3a2d9a3811fcfbd3bbf8ac3c40d36", size = 1994679, upload-time = "2025-11-04T13:40:50.619Z" }, + { url = "https://files.pythonhosted.org/packages/9e/8b/341991b158ddab181cff136acd2552c9f35bd30380422a639c0671e99a91/pydantic_core-2.41.5-cp313-cp313-win_amd64.whl", hash = "sha256:79ec52ec461e99e13791ec6508c722742ad745571f234ea6255bed38c6480f11", size = 2019766, upload-time = "2025-11-04T13:40:52.631Z" }, + { url = "https://files.pythonhosted.org/packages/73/7d/f2f9db34af103bea3e09735bb40b021788a5e834c81eedb541991badf8f5/pydantic_core-2.41.5-cp313-cp313-win_arm64.whl", hash = "sha256:3f84d5c1b4ab906093bdc1ff10484838aca54ef08de4afa9de0f5f14d69639cd", size = 1981005, upload-time = "2025-11-04T13:40:54.734Z" }, + { url = "https://files.pythonhosted.org/packages/ea/28/46b7c5c9635ae96ea0fbb779e271a38129df2550f763937659ee6c5dbc65/pydantic_core-2.41.5-cp314-cp314-macosx_10_12_x86_64.whl", hash = "sha256:3f37a19d7ebcdd20b96485056ba9e8b304e27d9904d233d7b1015db320e51f0a", size = 2119622, upload-time = "2025-11-04T13:40:56.68Z" }, + { url = "https://files.pythonhosted.org/packages/74/1a/145646e5687e8d9a1e8d09acb278c8535ebe9e972e1f162ed338a622f193/pydantic_core-2.41.5-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:1d1d9764366c73f996edd17abb6d9d7649a7eb690006ab6adbda117717099b14", size = 1891725, upload-time = "2025-11-04T13:40:58.807Z" }, + { url = "https://files.pythonhosted.org/packages/23/04/e89c29e267b8060b40dca97bfc64a19b2a3cf99018167ea1677d96368273/pydantic_core-2.41.5-cp314-cp314-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:25e1c2af0fce638d5f1988b686f3b3ea8cd7de5f244ca147c777769e798a9cd1", size = 1915040, upload-time = "2025-11-04T13:41:00.853Z" }, + { url = "https://files.pythonhosted.org/packages/84/a3/15a82ac7bd97992a82257f777b3583d3e84bdb06ba6858f745daa2ec8a85/pydantic_core-2.41.5-cp314-cp314-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:506d766a8727beef16b7adaeb8ee6217c64fc813646b424d0804d67c16eddb66", size = 2063691, upload-time = "2025-11-04T13:41:03.504Z" }, + { url = "https://files.pythonhosted.org/packages/74/9b/0046701313c6ef08c0c1cf0e028c67c770a4e1275ca73131563c5f2a310a/pydantic_core-2.41.5-cp314-cp314-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:4819fa52133c9aa3c387b3328f25c1facc356491e6135b459f1de698ff64d869", size = 2213897, upload-time = "2025-11-04T13:41:05.804Z" }, + { url = "https://files.pythonhosted.org/packages/8a/cd/6bac76ecd1b27e75a95ca3a9a559c643b3afcd2dd62086d4b7a32a18b169/pydantic_core-2.41.5-cp314-cp314-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:2b761d210c9ea91feda40d25b4efe82a1707da2ef62901466a42492c028553a2", size = 2333302, upload-time = "2025-11-04T13:41:07.809Z" }, + { url = "https://files.pythonhosted.org/packages/4c/d2/ef2074dc020dd6e109611a8be4449b98cd25e1b9b8a303c2f0fca2f2bcf7/pydantic_core-2.41.5-cp314-cp314-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:22f0fb8c1c583a3b6f24df2470833b40207e907b90c928cc8d3594b76f874375", size = 2064877, upload-time = "2025-11-04T13:41:09.827Z" }, + { url = "https://files.pythonhosted.org/packages/18/66/e9db17a9a763d72f03de903883c057b2592c09509ccfe468187f2a2eef29/pydantic_core-2.41.5-cp314-cp314-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:2782c870e99878c634505236d81e5443092fba820f0373997ff75f90f68cd553", size = 2180680, upload-time = "2025-11-04T13:41:12.379Z" }, + { url = "https://files.pythonhosted.org/packages/d3/9e/3ce66cebb929f3ced22be85d4c2399b8e85b622db77dad36b73c5387f8f8/pydantic_core-2.41.5-cp314-cp314-musllinux_1_1_aarch64.whl", hash = "sha256:0177272f88ab8312479336e1d777f6b124537d47f2123f89cb37e0accea97f90", size = 2138960, upload-time = "2025-11-04T13:41:14.627Z" }, + { url = "https://files.pythonhosted.org/packages/a6/62/205a998f4327d2079326b01abee48e502ea739d174f0a89295c481a2272e/pydantic_core-2.41.5-cp314-cp314-musllinux_1_1_armv7l.whl", hash = "sha256:63510af5e38f8955b8ee5687740d6ebf7c2a0886d15a6d65c32814613681bc07", size = 2339102, upload-time = "2025-11-04T13:41:16.868Z" }, + { url = "https://files.pythonhosted.org/packages/3c/0d/f05e79471e889d74d3d88f5bd20d0ed189ad94c2423d81ff8d0000aab4ff/pydantic_core-2.41.5-cp314-cp314-musllinux_1_1_x86_64.whl", hash = "sha256:e56ba91f47764cc14f1daacd723e3e82d1a89d783f0f5afe9c364b8bb491ccdb", size = 2326039, upload-time = "2025-11-04T13:41:18.934Z" }, + { url = "https://files.pythonhosted.org/packages/ec/e1/e08a6208bb100da7e0c4b288eed624a703f4d129bde2da475721a80cab32/pydantic_core-2.41.5-cp314-cp314-win32.whl", hash = "sha256:aec5cf2fd867b4ff45b9959f8b20ea3993fc93e63c7363fe6851424c8a7e7c23", size = 1995126, upload-time = "2025-11-04T13:41:21.418Z" }, + { url = "https://files.pythonhosted.org/packages/48/5d/56ba7b24e9557f99c9237e29f5c09913c81eeb2f3217e40e922353668092/pydantic_core-2.41.5-cp314-cp314-win_amd64.whl", hash = "sha256:8e7c86f27c585ef37c35e56a96363ab8de4e549a95512445b85c96d3e2f7c1bf", size = 2015489, upload-time = "2025-11-04T13:41:24.076Z" }, + { url = "https://files.pythonhosted.org/packages/4e/bb/f7a190991ec9e3e0ba22e4993d8755bbc4a32925c0b5b42775c03e8148f9/pydantic_core-2.41.5-cp314-cp314-win_arm64.whl", hash = "sha256:e672ba74fbc2dc8eea59fb6d4aed6845e6905fc2a8afe93175d94a83ba2a01a0", size = 1977288, upload-time = "2025-11-04T13:41:26.33Z" }, + { url = "https://files.pythonhosted.org/packages/92/ed/77542d0c51538e32e15afe7899d79efce4b81eee631d99850edc2f5e9349/pydantic_core-2.41.5-cp314-cp314t-macosx_10_12_x86_64.whl", hash = "sha256:8566def80554c3faa0e65ac30ab0932b9e3a5cd7f8323764303d468e5c37595a", size = 2120255, upload-time = "2025-11-04T13:41:28.569Z" }, + { url = "https://files.pythonhosted.org/packages/bb/3d/6913dde84d5be21e284439676168b28d8bbba5600d838b9dca99de0fad71/pydantic_core-2.41.5-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:b80aa5095cd3109962a298ce14110ae16b8c1aece8b72f9dafe81cf597ad80b3", size = 1863760, upload-time = "2025-11-04T13:41:31.055Z" }, + { url = "https://files.pythonhosted.org/packages/5a/f0/e5e6b99d4191da102f2b0eb9687aaa7f5bea5d9964071a84effc3e40f997/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:3006c3dd9ba34b0c094c544c6006cc79e87d8612999f1a5d43b769b89181f23c", size = 1878092, upload-time = "2025-11-04T13:41:33.21Z" }, + { url = "https://files.pythonhosted.org/packages/71/48/36fb760642d568925953bcc8116455513d6e34c4beaa37544118c36aba6d/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:72f6c8b11857a856bcfa48c86f5368439f74453563f951e473514579d44aa612", size = 2053385, upload-time = "2025-11-04T13:41:35.508Z" }, + { url = "https://files.pythonhosted.org/packages/20/25/92dc684dd8eb75a234bc1c764b4210cf2646479d54b47bf46061657292a8/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:5cb1b2f9742240e4bb26b652a5aeb840aa4b417c7748b6f8387927bc6e45e40d", size = 2218832, upload-time = "2025-11-04T13:41:37.732Z" }, + { url = "https://files.pythonhosted.org/packages/e2/09/f53e0b05023d3e30357d82eb35835d0f6340ca344720a4599cd663dca599/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:bd3d54f38609ff308209bd43acea66061494157703364ae40c951f83ba99a1a9", size = 2327585, upload-time = "2025-11-04T13:41:40Z" }, + { url = "https://files.pythonhosted.org/packages/aa/4e/2ae1aa85d6af35a39b236b1b1641de73f5a6ac4d5a7509f77b814885760c/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:2ff4321e56e879ee8d2a879501c8e469414d948f4aba74a2d4593184eb326660", size = 2041078, upload-time = "2025-11-04T13:41:42.323Z" }, + { url = "https://files.pythonhosted.org/packages/cd/13/2e215f17f0ef326fc72afe94776edb77525142c693767fc347ed6288728d/pydantic_core-2.41.5-cp314-cp314t-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:d0d2568a8c11bf8225044aa94409e21da0cb09dcdafe9ecd10250b2baad531a9", size = 2173914, upload-time = "2025-11-04T13:41:45.221Z" }, + { url = "https://files.pythonhosted.org/packages/02/7a/f999a6dcbcd0e5660bc348a3991c8915ce6599f4f2c6ac22f01d7a10816c/pydantic_core-2.41.5-cp314-cp314t-musllinux_1_1_aarch64.whl", hash = "sha256:a39455728aabd58ceabb03c90e12f71fd30fa69615760a075b9fec596456ccc3", size = 2129560, upload-time = "2025-11-04T13:41:47.474Z" }, + { url = "https://files.pythonhosted.org/packages/3a/b1/6c990ac65e3b4c079a4fb9f5b05f5b013afa0f4ed6780a3dd236d2cbdc64/pydantic_core-2.41.5-cp314-cp314t-musllinux_1_1_armv7l.whl", hash = "sha256:239edca560d05757817c13dc17c50766136d21f7cd0fac50295499ae24f90fdf", size = 2329244, upload-time = "2025-11-04T13:41:49.992Z" }, + { url = "https://files.pythonhosted.org/packages/d9/02/3c562f3a51afd4d88fff8dffb1771b30cfdfd79befd9883ee094f5b6c0d8/pydantic_core-2.41.5-cp314-cp314t-musllinux_1_1_x86_64.whl", hash = "sha256:2a5e06546e19f24c6a96a129142a75cee553cc018ffee48a460059b1185f4470", size = 2331955, upload-time = "2025-11-04T13:41:54.079Z" }, + { url = "https://files.pythonhosted.org/packages/5c/96/5fb7d8c3c17bc8c62fdb031c47d77a1af698f1d7a406b0f79aaa1338f9ad/pydantic_core-2.41.5-cp314-cp314t-win32.whl", hash = "sha256:b4ececa40ac28afa90871c2cc2b9ffd2ff0bf749380fbdf57d165fd23da353aa", size = 1988906, upload-time = "2025-11-04T13:41:56.606Z" }, + { url = "https://files.pythonhosted.org/packages/22/ed/182129d83032702912c2e2d8bbe33c036f342cc735737064668585dac28f/pydantic_core-2.41.5-cp314-cp314t-win_amd64.whl", hash = "sha256:80aa89cad80b32a912a65332f64a4450ed00966111b6615ca6816153d3585a8c", size = 1981607, upload-time = "2025-11-04T13:41:58.889Z" }, + { url = "https://files.pythonhosted.org/packages/9f/ed/068e41660b832bb0b1aa5b58011dea2a3fe0ba7861ff38c4d4904c1c1a99/pydantic_core-2.41.5-cp314-cp314t-win_arm64.whl", hash = "sha256:35b44f37a3199f771c3eaa53051bc8a70cd7b54f333531c59e29fd4db5d15008", size = 1974769, upload-time = "2025-11-04T13:42:01.186Z" }, + { url = "https://files.pythonhosted.org/packages/11/72/90fda5ee3b97e51c494938a4a44c3a35a9c96c19bba12372fb9c634d6f57/pydantic_core-2.41.5-graalpy311-graalpy242_311_native-macosx_10_12_x86_64.whl", hash = "sha256:b96d5f26b05d03cc60f11a7761a5ded1741da411e7fe0909e27a5e6a0cb7b034", size = 2115441, upload-time = "2025-11-04T13:42:39.557Z" }, + { url = "https://files.pythonhosted.org/packages/1f/53/8942f884fa33f50794f119012dc6a1a02ac43a56407adaac20463df8e98f/pydantic_core-2.41.5-graalpy311-graalpy242_311_native-macosx_11_0_arm64.whl", hash = "sha256:634e8609e89ceecea15e2d61bc9ac3718caaaa71963717bf3c8f38bfde64242c", size = 1930291, upload-time = "2025-11-04T13:42:42.169Z" }, + { url = "https://files.pythonhosted.org/packages/79/c8/ecb9ed9cd942bce09fc888ee960b52654fbdbede4ba6c2d6e0d3b1d8b49c/pydantic_core-2.41.5-graalpy311-graalpy242_311_native-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:93e8740d7503eb008aa2df04d3b9735f845d43ae845e6dcd2be0b55a2da43cd2", size = 1948632, upload-time = "2025-11-04T13:42:44.564Z" }, + { url = "https://files.pythonhosted.org/packages/2e/1b/687711069de7efa6af934e74f601e2a4307365e8fdc404703afc453eab26/pydantic_core-2.41.5-graalpy311-graalpy242_311_native-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:f15489ba13d61f670dcc96772e733aad1a6f9c429cc27574c6cdaed82d0146ad", size = 2138905, upload-time = "2025-11-04T13:42:47.156Z" }, + { url = "https://files.pythonhosted.org/packages/09/32/59b0c7e63e277fa7911c2fc70ccfb45ce4b98991e7ef37110663437005af/pydantic_core-2.41.5-graalpy312-graalpy250_312_native-macosx_10_12_x86_64.whl", hash = "sha256:7da7087d756b19037bc2c06edc6c170eeef3c3bafcb8f532ff17d64dc427adfd", size = 2110495, upload-time = "2025-11-04T13:42:49.689Z" }, + { url = "https://files.pythonhosted.org/packages/aa/81/05e400037eaf55ad400bcd318c05bb345b57e708887f07ddb2d20e3f0e98/pydantic_core-2.41.5-graalpy312-graalpy250_312_native-macosx_11_0_arm64.whl", hash = "sha256:aabf5777b5c8ca26f7824cb4a120a740c9588ed58df9b2d196ce92fba42ff8dc", size = 1915388, upload-time = "2025-11-04T13:42:52.215Z" }, + { url = "https://files.pythonhosted.org/packages/6e/0d/e3549b2399f71d56476b77dbf3cf8937cec5cd70536bdc0e374a421d0599/pydantic_core-2.41.5-graalpy312-graalpy250_312_native-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:c007fe8a43d43b3969e8469004e9845944f1a80e6acd47c150856bb87f230c56", size = 1942879, upload-time = "2025-11-04T13:42:56.483Z" }, + { url = "https://files.pythonhosted.org/packages/f7/07/34573da085946b6a313d7c42f82f16e8920bfd730665de2d11c0c37a74b5/pydantic_core-2.41.5-graalpy312-graalpy250_312_native-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:76d0819de158cd855d1cbb8fcafdf6f5cf1eb8e470abe056d5d161106e38062b", size = 2139017, upload-time = "2025-11-04T13:42:59.471Z" }, + { url = "https://files.pythonhosted.org/packages/5f/9b/1b3f0e9f9305839d7e84912f9e8bfbd191ed1b1ef48083609f0dabde978c/pydantic_core-2.41.5-pp311-pypy311_pp73-macosx_10_12_x86_64.whl", hash = "sha256:b2379fa7ed44ddecb5bfe4e48577d752db9fc10be00a6b7446e9663ba143de26", size = 2101980, upload-time = "2025-11-04T13:43:25.97Z" }, + { url = "https://files.pythonhosted.org/packages/a4/ed/d71fefcb4263df0da6a85b5d8a7508360f2f2e9b3bf5814be9c8bccdccc1/pydantic_core-2.41.5-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:266fb4cbf5e3cbd0b53669a6d1b039c45e3ce651fd5442eff4d07c2cc8d66808", size = 1923865, upload-time = "2025-11-04T13:43:28.763Z" }, + { url = "https://files.pythonhosted.org/packages/ce/3a/626b38db460d675f873e4444b4bb030453bbe7b4ba55df821d026a0493c4/pydantic_core-2.41.5-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:58133647260ea01e4d0500089a8c4f07bd7aa6ce109682b1426394988d8aaacc", size = 2134256, upload-time = "2025-11-04T13:43:31.71Z" }, + { url = "https://files.pythonhosted.org/packages/83/d9/8412d7f06f616bbc053d30cb4e5f76786af3221462ad5eee1f202021eb4e/pydantic_core-2.41.5-pp311-pypy311_pp73-manylinux_2_5_i686.manylinux1_i686.whl", hash = "sha256:287dad91cfb551c363dc62899a80e9e14da1f0e2b6ebde82c806612ca2a13ef1", size = 2174762, upload-time = "2025-11-04T13:43:34.744Z" }, + { url = "https://files.pythonhosted.org/packages/55/4c/162d906b8e3ba3a99354e20faa1b49a85206c47de97a639510a0e673f5da/pydantic_core-2.41.5-pp311-pypy311_pp73-musllinux_1_1_aarch64.whl", hash = "sha256:03b77d184b9eb40240ae9fd676ca364ce1085f203e1b1256f8ab9984dca80a84", size = 2143141, upload-time = "2025-11-04T13:43:37.701Z" }, + { url = "https://files.pythonhosted.org/packages/1f/f2/f11dd73284122713f5f89fc940f370d035fa8e1e078d446b3313955157fe/pydantic_core-2.41.5-pp311-pypy311_pp73-musllinux_1_1_armv7l.whl", hash = "sha256:a668ce24de96165bb239160b3d854943128f4334822900534f2fe947930e5770", size = 2330317, upload-time = "2025-11-04T13:43:40.406Z" }, + { url = "https://files.pythonhosted.org/packages/88/9d/b06ca6acfe4abb296110fb1273a4d848a0bfb2ff65f3ee92127b3244e16b/pydantic_core-2.41.5-pp311-pypy311_pp73-musllinux_1_1_x86_64.whl", hash = "sha256:f14f8f046c14563f8eb3f45f499cc658ab8d10072961e07225e507adb700e93f", size = 2316992, upload-time = "2025-11-04T13:43:43.602Z" }, + { url = "https://files.pythonhosted.org/packages/36/c7/cfc8e811f061c841d7990b0201912c3556bfeb99cdcb7ed24adc8d6f8704/pydantic_core-2.41.5-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:56121965f7a4dc965bff783d70b907ddf3d57f6eba29b6d2e5dabfaf07799c51", size = 2145302, upload-time = "2025-11-04T13:43:46.64Z" }, +] + +[[package]] +name = "pygments" +version = "2.20.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/c3/b2/bc9c9196916376152d655522fdcebac55e66de6603a76a02bca1b6414f6c/pygments-2.20.0.tar.gz", hash = "sha256:6757cd03768053ff99f3039c1a36d6c0aa0b263438fcab17520b30a303a82b5f", size = 4955991, upload-time = "2026-03-29T13:29:33.898Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f4/7e/a72dd26f3b0f4f2bf1dd8923c85f7ceb43172af56d63c7383eb62b332364/pygments-2.20.0-py3-none-any.whl", hash = "sha256:81a9e26dd42fd28a23a2d169d86d7ac03b46e2f8b59ed4698fb4785f946d0176", size = 1231151, upload-time = "2026-03-29T13:29:30.038Z" }, +] + +[[package]] +name = "pyinstaller" +version = "6.21.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "altgraph" }, + { name = "macholib", marker = "sys_platform == 'darwin'" }, + { name = "packaging" }, + { name = "pefile", marker = "sys_platform == 'win32'" }, + { name = "pyinstaller-hooks-contrib" }, + { name = "pywin32-ctypes", marker = "sys_platform == 'win32'" }, + { name = "setuptools" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/d5/4d/ec706c3fcf39e26888c35b39615ff4d5865d184069666c47492cff1fbe50/pyinstaller-6.21.0.tar.gz", hash = "sha256:bb9fab705983e393a2d1cac77d6972513057ad800215fd861dc15ff5272e98fd", size = 4061519, upload-time = "2026-06-13T14:15:06.25Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0c/4a/53cf98bf66daed012dc9cd78c8203f19a675d696f2fc12afcf8c5049a0e0/pyinstaller-6.21.0-py3-none-macosx_10_13_universal2.whl", hash = "sha256:327d132389f37912609e01be62810cf96b5aa95b613903e4b8692e0d12fb0eda", size = 1052350, upload-time = "2026-06-13T14:13:55.88Z" }, + { url = "https://files.pythonhosted.org/packages/30/83/b591295c352ef464c50b4c6ffff1c4f771d875c9e833f578d1b9f564f6b3/pyinstaller-6.21.0-py3-none-manylinux2014_aarch64.whl", hash = "sha256:7071d4b094d5b40deeef5fa3d3b98a1b846087f7562b49209663d5f9281fe251", size = 748477, upload-time = "2026-06-13T14:14:00.327Z" }, + { url = "https://files.pythonhosted.org/packages/3d/8f/88fff4e403873b1e22286911350e75ff00db014aa08e57045da9d4328993/pyinstaller-6.21.0-py3-none-manylinux2014_i686.whl", hash = "sha256:6b6374d652107dd4a2eeece903ff82bb4045bb5e1006c5a158a6dcdbefe84bf2", size = 760877, upload-time = "2026-06-13T14:14:04.836Z" }, + { url = "https://files.pythonhosted.org/packages/8a/13/f0e48fbdfd1d05d948157121cea8b1b823dcb89efe6934b71fdd8bdb3f0f/pyinstaller-6.21.0-py3-none-manylinux2014_ppc64le.whl", hash = "sha256:4e3108b3f02384560da70e39b8bf22b0ad597d02bd68a40d76ea91c1cfa00cad", size = 759194, upload-time = "2026-06-13T14:14:10.61Z" }, + { url = "https://files.pythonhosted.org/packages/dd/d5/ea7878cf9924ed30d946d8288777424e6d069d94f5bde56b4d0890069664/pyinstaller-6.21.0-py3-none-manylinux2014_s390x.whl", hash = "sha256:697532279f535ad572bda613db4f821540e235c7854ca6da4d3bf0373f4415ee", size = 754979, upload-time = "2026-06-13T14:14:15.226Z" }, + { url = "https://files.pythonhosted.org/packages/9f/09/51b8905714b733bac66dbc041a7821372d70d888d273ae474c4037d4202d/pyinstaller-6.21.0-py3-none-manylinux2014_x86_64.whl", hash = "sha256:605169523a6b5ace39f13dfbff21add9f2bc43df99c7daf9394fefb2c45e8b6f", size = 754812, upload-time = "2026-06-13T14:14:20.264Z" }, + { url = "https://files.pythonhosted.org/packages/4b/43/d77779439d8c6c2e27a77bcfbd1d5cc0f568ebb611bb472b11af81b5f177/pyinstaller-6.21.0-py3-none-musllinux_1_1_aarch64.whl", hash = "sha256:5fa56746c1e76f93634d018502301378a2d0c382553d37d8c3c34ff436c12dd1", size = 753887, upload-time = "2026-06-13T14:14:25.268Z" }, + { url = "https://files.pythonhosted.org/packages/51/8f/c22df1f6837784ac349057ba693f08e7b1ca7a0e06f9c33c63bc6280007b/pyinstaller-6.21.0-py3-none-musllinux_1_1_x86_64.whl", hash = "sha256:42395ec76df8e8120c36b13339d9db8cab83e316a12839ee303cc00fc941bb74", size = 753779, upload-time = "2026-06-13T14:14:29.445Z" }, + { url = "https://files.pythonhosted.org/packages/c9/76/1ce8a27ce62ba8cf3a87c9ce6d575610f4e55d7cb0123e7512fc3f4b921a/pyinstaller-6.21.0-py3-none-win32.whl", hash = "sha256:c6b28d30d8fd99ce162ff3aab5013ed44dbfb747566b1f01b9bed7964d7c14e9", size = 1336462, upload-time = "2026-06-13T14:14:35.785Z" }, + { url = "https://files.pythonhosted.org/packages/c1/fa/ca1d7e5257dd8566a9dfc0dfb02f8a8075eeb53d4b2d3c579f1276759042/pyinstaller-6.21.0-py3-none-win_amd64.whl", hash = "sha256:7fae06c494ce0ebfe6bd3055c0e409def884f63af2e3705d06bd431ad9237fc7", size = 1397487, upload-time = "2026-06-13T14:14:42.328Z" }, + { url = "https://files.pythonhosted.org/packages/dc/75/21b51523ce8d96629b71311775a0a65f5f5a872124ab0de33e5c848f8bff/pyinstaller-6.21.0-py3-none-win_arm64.whl", hash = "sha256:f13c95c9c03fb567217135919f93815c305813126780b0ed6e0123cb8acaf025", size = 1346094, upload-time = "2026-06-13T14:14:48.914Z" }, +] + +[[package]] +name = "pyinstaller-hooks-contrib" +version = "2026.6" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "packaging" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/94/5b/c9fe0db5e83ee1c39b2258fa21d23b15e1a60786b6c5990ee5074ead8bb6/pyinstaller_hooks_contrib-2026.6.tar.gz", hash = "sha256:bef5002c32f4f50bd55b005da12cff64eca8783e7eaf86a06a62410164bab725", size = 173354, upload-time = "2026-06-08T22:37:16.152Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e7/31/f2d7343d8ed5f7c4678377886f6ce533e6eaaa131b252ce950114c2a7efa/pyinstaller_hooks_contrib-2026.6-py3-none-any.whl", hash = "sha256:fd13b8ac126b35361175edacd41a0d97080b75dd5f4b594ecefefff969509dd3", size = 457159, upload-time = "2026-06-08T22:37:14.722Z" }, +] + +[[package]] +name = "pyobjc-core" +version = "12.2.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/b4/b1/729f7458a63758bd21716648a8abcd9a0c8f2d2e9897763c8a1a1c7fd31b/pyobjc_core-12.2.1.tar.gz", hash = "sha256:7a7b9b018402342cf32bf1956366896350fbe5c0478cb3ef59778f77abed7f07", size = 1063383, upload-time = "2026-06-19T16:19:39.357Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/92/87/16564ef5e4568ee0edd9e712d8111dc8b67621d6bb6ff430646ee2d637dd/pyobjc_core-12.2.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:24b76a63caf0b5369d4a377c7c0438cd70df81539057af3db839bfaa3579e04a", size = 6484662, upload-time = "2026-06-19T16:04:44.979Z" }, + { url = "https://files.pythonhosted.org/packages/8c/88/300ad283bed0c971c52dcac6f70113e138169d4ce6d856ddd03d16081e51/pyobjc_core-12.2.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:a64232bb27ed101d4adc7d42b0e64a6d3331aac7bee7861c037a6777a163f10b", size = 6433347, upload-time = "2026-06-19T16:04:49.341Z" }, + { url = "https://files.pythonhosted.org/packages/3e/1e/b9b0ddffae66996b8779f1f7958adc9f21c13a0448cd3be8d7fe589b5b0f/pyobjc_core-12.2.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:af101222762665a4125157906cb4b23f5d5a63d3851d5e0504f72a1eaaa2cfd2", size = 6436004, upload-time = "2026-06-19T16:04:53.257Z" }, + { url = "https://files.pythonhosted.org/packages/8f/26/bd309ede07784c6e5fac4b440c90a5f72a66da7859ed303a9392fe8a5f3f/pyobjc_core-12.2.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:efe465e3ecc6fc73f7c7622620345d134a8d34564ab1c29d8247e45f4ed55071", size = 6687044, upload-time = "2026-06-19T16:04:57.42Z" }, + { url = "https://files.pythonhosted.org/packages/bd/8a/cfa4f56939d554dbb342ec6e5226a441e2f552bc2002a0ddf7705bb11bef/pyobjc_core-12.2.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:2b8fc0531c27277325e113ac00b8a72a82e6145f0a88175b9425d8de814ff69a", size = 6429289, upload-time = "2026-06-19T16:05:02.191Z" }, + { url = "https://files.pythonhosted.org/packages/42/74/446c89bc18103aaa4a00d1fb85ff8acace9a0dc3f362d9678ebf7571e275/pyobjc_core-12.2.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:9bef500f979e22d54f9da3aaebf6a48f873234b324858bd69256055a318955c7", size = 6690181, upload-time = "2026-06-19T16:05:06.201Z" }, + { url = "https://files.pythonhosted.org/packages/99/c7/0121ee4c616af07ad2de8cd1a286f6978dc9a227eb58b7c2e875cb68a1df/pyobjc_core-12.2.1-cp315-cp315-macosx_10_15_universal2.whl", hash = "sha256:047c226eeb58a2993ace5e8904e71cc9426ee20d064c617f8fbf32717d37093e", size = 6487078, upload-time = "2026-06-19T16:05:10.093Z" }, + { url = "https://files.pythonhosted.org/packages/b5/a8/cb9fcc150f97d0bf22a2028f88b24cc35949beb1bcc7b8bc5c17d4401677/pyobjc_core-12.2.1-cp315-cp315t-macosx_10_15_universal2.whl", hash = "sha256:1188613805336270279570467e4455b74cb6c0f60913ac74c917ee1c37cfaecb", size = 6733064, upload-time = "2026-06-19T16:05:14.313Z" }, +] + +[[package]] +name = "pyobjc-framework-cocoa" +version = "12.2.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pyobjc-core", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/51/34/fbe38a204643aa4e1b91391cdce07a34da565a69171ebcad08de7438a556/pyobjc_framework_cocoa-12.2.1.tar.gz", hash = "sha256:b94b37fe5730e5ae1fb0052912cd174e6ec329b0bfba4a012ae5db1014b5864b", size = 3125751, upload-time = "2026-06-19T16:20:05.159Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f4/d6/dc66ea8519a0475efbccf73f82cc28066339bb300a27f5e1bf91ab1d7002/pyobjc_framework_cocoa-12.2.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:dc6da84f4fc62cc25463bbb85e77a57b8d5ac6caf9a60702daf2edb601332f15", size = 387298, upload-time = "2026-06-19T16:07:37.412Z" }, + { url = "https://files.pythonhosted.org/packages/f7/cf/1b3b32b2f28f66cc053c3438ef4e6df36a1591945bf05e7399da18d74553/pyobjc_framework_cocoa-12.2.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:28b9b8bab1c36efb94744786918752d0c1842f5fbb67e7d5ca97b5f736512080", size = 388113, upload-time = "2026-06-19T16:07:38.9Z" }, + { url = "https://files.pythonhosted.org/packages/cc/46/68e8e4d926a2f70fed0437047bc3f9fe08af8fe620d94d80656ebc3cfa9b/pyobjc_framework_cocoa-12.2.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:3b74a78fa7803e547b32e5e8ec1b49987b52fe318383e793bc6cd49b80efbd9f", size = 388183, upload-time = "2026-06-19T16:07:40.483Z" }, + { url = "https://files.pythonhosted.org/packages/2e/f3/dfc9af4c9eb2e5389c860ad5ef252be9fe456db09f39d537555dc5057aa1/pyobjc_framework_cocoa-12.2.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:dc2eaca2f13c7bcd8e41e51a372e47825dea9dd3126108760eed7ba883d2945c", size = 392275, upload-time = "2026-06-19T16:07:42.078Z" }, + { url = "https://files.pythonhosted.org/packages/ec/c8/b90baa8f3592eded79b4be98fb59d2b8dc16b62361e34292bd95806ebd9f/pyobjc_framework_cocoa-12.2.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:b386c324d64ae565c1f6b7dfb77be68f640a1c7c23caa6966ab661131f519561", size = 388357, upload-time = "2026-06-19T16:07:43.364Z" }, + { url = "https://files.pythonhosted.org/packages/98/d8/64a94651b9294702d55e748d94de30e25bc59d0784526be7643f4467eccd/pyobjc_framework_cocoa-12.2.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:a6c584e2af0813cb2f6103b184e632665a26f58c1bd5b08ffd6e95a19c617f7b", size = 392404, upload-time = "2026-06-19T16:07:44.955Z" }, + { url = "https://files.pythonhosted.org/packages/5c/cc/26e8a7bf1f5e8caa38b7f80d486296f9fd3c97e71ad7e5444ef22e802758/pyobjc_framework_cocoa-12.2.1-cp315-cp315-macosx_10_15_universal2.whl", hash = "sha256:b6023657b8d6cc049a21bd6b4752425f2f53c42f9f0b02d64c7608cc484bf103", size = 388589, upload-time = "2026-06-19T16:07:46.276Z" }, + { url = "https://files.pythonhosted.org/packages/b6/f3/eedf743a303ea742b8e082afe3613fb4d6618bc1a48cf2568b004ce906f7/pyobjc_framework_cocoa-12.2.1-cp315-cp315t-macosx_10_15_universal2.whl", hash = "sha256:c685ccd8e266a07cf912a2c5a13b1f2eff2a868a1aff163b4801b4687bd425e1", size = 392691, upload-time = "2026-06-19T16:07:47.477Z" }, +] + +[[package]] +name = "pyobjc-framework-quartz" +version = "12.2.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pyobjc-core", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "pyobjc-framework-cocoa", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/3b/f6/2a8b84dbf1fe7c04dd96ea73d991678d4e09a909f51971ecc51629bb2ab4/pyobjc_framework_quartz-12.2.1.tar.gz", hash = "sha256:b3b8b6f71e66147f8ff9e6213864cc8527e3a0b1ee90835b93ce221f4802d9b0", size = 3215521, upload-time = "2026-06-19T16:21:30.199Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b9/08/527d1ff856e2f2446b5887be01989cc08f9adaf3de7d4eb13d07826c362f/pyobjc_framework_quartz-12.2.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:60f29408b4f9ed5391a29c6b63e2aa56ddfb8b66b3fb47962930427981e14462", size = 217998, upload-time = "2026-06-19T16:16:02.978Z" }, + { url = "https://files.pythonhosted.org/packages/14/fc/d7c7b3134cdbd1a487f3f77b5be125d87a6c9e7d9411035739d99335cc0c/pyobjc_framework_quartz-12.2.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:de9c8cca7e95290c8d540466af11c7cdfe3a5458e6f56c34006d5b45243f9ed9", size = 219000, upload-time = "2026-06-19T16:16:04.29Z" }, + { url = "https://files.pythonhosted.org/packages/0a/4b/861f91a1565d3189ee899e177b915551fb9a7e2ca25414025a8974f04e74/pyobjc_framework_quartz-12.2.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:54c9bc7f507192691841ee4eba5bf36990b259df83ac728efed2d7ea1cd021e4", size = 219403, upload-time = "2026-06-19T16:16:05.645Z" }, + { url = "https://files.pythonhosted.org/packages/ba/b5/b27010d2f288737f627f74be6d5549f49c841542365c84b9a3011fe39ce7/pyobjc_framework_quartz-12.2.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:bfc0d2badd819823d21df8069dcf9544ce360ed747a8895c51bdb25d8d125f45", size = 224458, upload-time = "2026-06-19T16:16:07.252Z" }, + { url = "https://files.pythonhosted.org/packages/8b/5d/85ffd9d433989205d572a50d625c63b29c05e0c5235a725f15ae1023672c/pyobjc_framework_quartz-12.2.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:ceb56939c337b36d9d81185ade31f77dc52c85cf79bb16e53e9b32f54b6bb3f5", size = 219769, upload-time = "2026-06-19T16:16:08.814Z" }, + { url = "https://files.pythonhosted.org/packages/e2/d6/b917e4b63d72ea84a27121076f3033f23f6497c0e6ce8d304766c899897f/pyobjc_framework_quartz-12.2.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:8105c98b798f2bf81c05c54bddeeadbf62f0b5dfec13bd6e719dd2cdf7e1cddf", size = 224717, upload-time = "2026-06-19T16:16:10.215Z" }, + { url = "https://files.pythonhosted.org/packages/04/e2/f3c1ed3228f7430ef5ade23db6f1fcbae99290f177ce5653348fd9e05f4d/pyobjc_framework_quartz-12.2.1-cp315-cp315-macosx_10_15_universal2.whl", hash = "sha256:bbc214f1a216b5d3651bc832d0ac4589f029f3f37cd6cbb370aac12a7c77942c", size = 219825, upload-time = "2026-06-19T16:16:11.433Z" }, + { url = "https://files.pythonhosted.org/packages/66/2a/2c99a5ad2fe0a11600ea123b8e9a08ff138fcb2ad1e13e376f4bd4aa1d96/pyobjc_framework_quartz-12.2.1-cp315-cp315t-macosx_10_15_universal2.whl", hash = "sha256:ca61624a0b0e6286d8a0f97f47eb9011e4e81e9a339db436d48af527e7065bb1", size = 224770, upload-time = "2026-06-19T16:16:13.035Z" }, +] + +[[package]] +name = "pyobjc-framework-security" +version = "12.2.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pyobjc-core", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "pyobjc-framework-cocoa", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/44/b8/4267b802d8dba6de468e7d0765b05cc4e146fa376ed9f55e0b6461016bef/pyobjc_framework_security-12.2.1.tar.gz", hash = "sha256:d7831b1537f4346892e7f2f0e2b09d79bee98919b0767f4061278d0e03028f2d", size = 181065, upload-time = "2026-06-19T16:21:40.151Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/be/ac/f2ff946edfaf16b4ce5e31afac5e519f83705c0f4842fd25134ecb8f2f4a/pyobjc_framework_security-12.2.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:ce461296b003b2ba17c8b65f6339f9d2fd5dcfa2b3b52ddc0a696334cc8974c5", size = 41306, upload-time = "2026-06-19T16:17:16.816Z" }, + { url = "https://files.pythonhosted.org/packages/4e/5b/2719bc4062e6c27083191fd20e365ae02d0bf1c22f4d1a88211e3d96b369/pyobjc_framework_security-12.2.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:76ff6e44e62d3e15651540493879bf16687d862c4f10f3cadade757811c8b8d0", size = 41300, upload-time = "2026-06-19T16:17:17.702Z" }, + { url = "https://files.pythonhosted.org/packages/15/90/dccd4cd6877ef208957dc1f3675287d8614a4dcd2a3ee0a5e56f5fb5a1ba/pyobjc_framework_security-12.2.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:990013baba29d6f985d8950b23701129b2597b3d16f628b785fe97596d8a8de3", size = 41299, upload-time = "2026-06-19T16:17:18.511Z" }, + { url = "https://files.pythonhosted.org/packages/ce/af/f9e8040e0c3ef6a50392a46ad1df482a666aa615180d40730b00282ff81f/pyobjc_framework_security-12.2.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:066a3e5e9d368e7a6ba8dd52be2077a634ef12a54fbfcc78b3b8154a8f988a1d", size = 42179, upload-time = "2026-06-19T16:17:19.48Z" }, + { url = "https://files.pythonhosted.org/packages/c9/3c/76e2a8bb8d5fe48f0e8e25c6abec1609f3667cc39935017badfe9e9603f2/pyobjc_framework_security-12.2.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:5319ae49b8874363ab51c6ff4d85d4ea0cfa6d836fe0306e901ba9ae560b880d", size = 41370, upload-time = "2026-06-19T16:17:20.501Z" }, + { url = "https://files.pythonhosted.org/packages/14/6e/7120956e9833b2c70757eec1f65f57c191e00662cf74c4545d88315643fa/pyobjc_framework_security-12.2.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:21618431e0dbfbd3d4029445e3118af88e5d7e52ddecf9a2d17c759c51628d85", size = 42926, upload-time = "2026-06-19T16:17:21.425Z" }, + { url = "https://files.pythonhosted.org/packages/b3/ff/0bafc557523e5755f74dd5363386a1e9b03f611e2e36df0737a508cd5ab4/pyobjc_framework_security-12.2.1-cp315-cp315-macosx_10_15_universal2.whl", hash = "sha256:fa192e9df479375e6242adcadb9a44f32907dd7fe1207608710cd3af65fe3c84", size = 41376, upload-time = "2026-06-19T16:17:22.337Z" }, + { url = "https://files.pythonhosted.org/packages/47/33/33d266117e46fef148caa4f986b3d896cb9bfd76bef48bd761cb60c758ee/pyobjc_framework_security-12.2.1-cp315-cp315t-macosx_10_15_universal2.whl", hash = "sha256:07cd044a7996f9a897040c49055fa3bdf565acac4a25b834a72e60602376146d", size = 42944, upload-time = "2026-06-19T16:17:23.371Z" }, +] + +[[package]] +name = "pyobjc-framework-webkit" +version = "12.2.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "pyobjc-core", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, + { name = "pyobjc-framework-cocoa", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/11/d2/b230c594f70ecb970b4cef67bae2648d1bfa5b381e9b7e3710bf24ec8887/pyobjc_framework_webkit-12.2.1.tar.gz", hash = "sha256:a56acae55b50d549b20dff2921ad1099add8fbc377d0de09ddc2ba50957f7def", size = 332374, upload-time = "2026-06-19T16:22:01.988Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f0/d3/2ab99d3975dd4624dd943e5a7c8d37e40258d3c9fcf4f26baf09a24e6c9b/pyobjc_framework_webkit-12.2.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:af5c4ccdf03845adac082823a3b4341b5b2fe62d2d664550afa705b5286a06fc", size = 50264, upload-time = "2026-06-19T16:19:30.607Z" }, + { url = "https://files.pythonhosted.org/packages/84/47/7a2099eb2e062c6230a9440f1795cf34056ca5e16ef25c8aad7c059b8734/pyobjc_framework_webkit-12.2.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:7e04dcc08cdc59380113ea1232af75a0a04c2426418ebe967b4c0045c973f776", size = 50372, upload-time = "2026-06-19T16:19:31.581Z" }, + { url = "https://files.pythonhosted.org/packages/2a/a4/202ec288808011d3f459d000d593e88b1118f2d1d5a4dfaaf5232f2c2ac2/pyobjc_framework_webkit-12.2.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:23bee8bf7077f91da4e3ae54a00c7f5e4414319e15f98be8584dbd67c4043fae", size = 50387, upload-time = "2026-06-19T16:19:32.522Z" }, + { url = "https://files.pythonhosted.org/packages/95/a4/f796e94b43a66704b6ae17c747c7b97fd4b79348f1cfa9bef7b008aaa718/pyobjc_framework_webkit-12.2.1-cp313-cp313t-macosx_10_13_universal2.whl", hash = "sha256:00ffb254f97e9ffdd0a82c1faa61a07f6072ba900fa8aba70c83c21198b52e4e", size = 50853, upload-time = "2026-06-19T16:19:33.43Z" }, + { url = "https://files.pythonhosted.org/packages/ae/f6/d24716fef19ccc3d880e99029458803f0174c05df310d991eb97ea3a0799/pyobjc_framework_webkit-12.2.1-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:67030258c3cd66e8495ccfccef3d2d58010ff0209284c5115e5afdb0e9fd6de1", size = 50499, upload-time = "2026-06-19T16:19:34.45Z" }, + { url = "https://files.pythonhosted.org/packages/a8/6c/817119a52efcc229a30ceff56a0641005a431806a1f555e0571626ba313a/pyobjc_framework_webkit-12.2.1-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:5d91527c9950c79269dd0d70f2bb8668c298dd06930637c1c063ce5f274a87e5", size = 50967, upload-time = "2026-06-19T16:19:35.474Z" }, + { url = "https://files.pythonhosted.org/packages/2d/59/5fac0754d53b2a72aed6f424dfc72e5fa245f83cb57c2e00d02e45390fca/pyobjc_framework_webkit-12.2.1-cp315-cp315-macosx_10_15_universal2.whl", hash = "sha256:657825081484c9920c50b76b469b9583f116225b0449c9d95c46cbc8c640adc8", size = 50498, upload-time = "2026-06-19T16:19:36.397Z" }, + { url = "https://files.pythonhosted.org/packages/da/0c/e997e33d99d4ad91da2cf70f0e51ac39b03c58ba210548e9e944bbb421be/pyobjc_framework_webkit-12.2.1-cp315-cp315t-macosx_10_15_universal2.whl", hash = "sha256:f46adcc6227873f2b14d74b2e789c937f227722274ab59b9fa3c04c6ecb46dd5", size = 50958, upload-time = "2026-06-19T16:19:37.424Z" }, +] + +[[package]] +name = "pyparsing" +version = "3.3.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/f3/91/9c6ee907786a473bf81c5f53cf703ba0957b23ab84c264080fb5a450416f/pyparsing-3.3.2.tar.gz", hash = "sha256:c777f4d763f140633dcb6d8a3eda953bf7a214dc4eff598413c070bcdc117cbc", size = 6851574, upload-time = "2026-01-21T03:57:59.36Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/10/bd/c038d7cc38edc1aa5bf91ab8068b63d4308c66c4c8bb3cbba7dfbc049f9c/pyparsing-3.3.2-py3-none-any.whl", hash = "sha256:850ba148bd908d7e2411587e247a1e4f0327839c40e2e5e6d05a007ecc69911d", size = 122781, upload-time = "2026-01-21T03:57:55.912Z" }, +] + +[[package]] +name = "pyteomics" +version = "4.7.5" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/1a/cd/b7eb951a99ad3ab425a2dbc6e38af076116d13ebcbe144019a2bd37dc093/pyteomics-4.7.5.tar.gz", hash = "sha256:382aeaa8b921bdd2a7e5b4aa9fe46c6184bb43701205a845b4b861ee3e88f46a", size = 236493, upload-time = "2024-10-18T13:26:29.903Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/92/59/2ea7637f20a0e2d082fc0cae021d20934aa49ac8154db817a1a3fa9e27b5/pyteomics-4.7.5-py2.py3-none-any.whl", hash = "sha256:9b8008ad8d8bbbc6856c4e804bc88e018df44809cd9a86900862b311e760862d", size = 238983, upload-time = "2024-10-18T13:26:25.923Z" }, + { url = "https://files.pythonhosted.org/packages/fb/62/b5d706255739553398d3a308d92e2476d5a363ad3ca0598c51bc75cc5054/pyteomics-4.7.5-py3-none-any.whl", hash = "sha256:5155e1d2581845926e49b0abd0be8cfd6ea45ffd3511958b805347037c5934c8", size = 238978, upload-time = "2024-10-18T13:26:27.764Z" }, +] + +[[package]] +name = "pytest" +version = "9.0.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "colorama", marker = "sys_platform == 'win32'" }, + { name = "iniconfig" }, + { name = "packaging" }, + { name = "pluggy" }, + { name = "pygments" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/d1/db/7ef3487e0fb0049ddb5ce41d3a49c235bf9ad299b6a25d5780a89f19230f/pytest-9.0.2.tar.gz", hash = "sha256:75186651a92bd89611d1d9fc20f0b4345fd827c41ccd5c299a868a05d70edf11", size = 1568901, upload-time = "2025-12-06T21:30:51.014Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/3b/ab/b3226f0bd7cdcf710fbede2b3548584366da3b19b5021e74f5bde2a8fa3f/pytest-9.0.2-py3-none-any.whl", hash = "sha256:711ffd45bf766d5264d487b917733b453d917afd2b0ad65223959f59089f875b", size = 374801, upload-time = "2025-12-06T21:30:49.154Z" }, +] + +[[package]] +name = "python-dateutil" +version = "2.9.0.post0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "six" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/66/c0/0c8b6ad9f17a802ee498c46e004a0eb49bc148f2fd230864601a86dcf6db/python-dateutil-2.9.0.post0.tar.gz", hash = "sha256:37dd54208da7e1cd875388217d5e00ebd4179249f90fb72437e91a35459a0ad3", size = 342432, upload-time = "2024-03-01T18:36:20.211Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ec/57/56b9bcc3c9c6a792fcbaf139543cee77261f3651ca9da0c93f5c1221264b/python_dateutil-2.9.0.post0-py2.py3-none-any.whl", hash = "sha256:a8b2bc7bffae282281c8140a97d3aa9c14da0b136dfe83f850eea9a5f7470427", size = 229892, upload-time = "2024-03-01T18:36:18.57Z" }, +] + +[[package]] +name = "python-dotenv" +version = "1.2.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/82/ed/0301aeeac3e5353ef3d94b6ec08bbcabd04a72018415dcb29e588514bba8/python_dotenv-1.2.2.tar.gz", hash = "sha256:2c371a91fbd7ba082c2c1dc1f8bf89ca22564a087c2c287cd9b662adde799cf3", size = 50135, upload-time = "2026-03-01T16:00:26.196Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0b/d7/1959b9648791274998a9c3526f6d0ec8fd2233e4d4acce81bbae76b44b2a/python_dotenv-1.2.2-py3-none-any.whl", hash = "sha256:1d8214789a24de455a8b8bd8ae6fe3c6b69a5e3d64aa8a8e5d68e694bbcb285a", size = 22101, upload-time = "2026-03-01T16:00:25.09Z" }, +] + +[[package]] +name = "python-engineio" +version = "4.13.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "simple-websocket" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/fb/a0/f75491f942184d9960b15e763270f765fe9f239745ca5f9e16289011aed4/python_engineio-4.13.3.tar.gz", hash = "sha256:572b7783e341fed21edbc7cea297ccd378dad79265fdde96aa4664420a7c06c9", size = 79734, upload-time = "2026-06-20T22:53:52.197Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/5b/96/82f6328e410515fab21d5602ba35b9377a47b5a141a0c1f9efa00ce21eb4/python_engineio-4.13.3-py3-none-any.whl", hash = "sha256:1f60ecaf1358190f0e26c48c578a60428dc02a8f1295bc3dbf53d1b31116821f", size = 59993, upload-time = "2026-06-20T22:53:50.775Z" }, +] + +[[package]] +name = "python-multipart" +version = "0.0.32" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/5b/42/55c32bb9b12693c092ad250a0e82edb5b31ddeda6eb772de5f308b3804ad/python_multipart-0.0.32.tar.gz", hash = "sha256:be54b7f3fa167bb83e4fcd936b887b708f4e57fe75911c02aebf53efaf8d938e", size = 46881, upload-time = "2026-06-04T16:18:58.647Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e1/04/e8135ebd1ad02c56ec633277529b2602ff99ff634be76cdba5744cf554fd/python_multipart-0.0.32-py3-none-any.whl", hash = "sha256:ff6d3f776f16878c894e52e107296ffc890e913c611b1a4ec6c44e2821fe2e23", size = 30042, upload-time = "2026-06-04T16:18:57.319Z" }, +] + +[[package]] +name = "python-socketio" +version = "5.16.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "bidict" }, + { name = "python-engineio" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/32/2d/ffce71017c106b75099fea569df6518c63fee5d6202ce0cfe7b01e6f22c3/python_socketio-5.16.3.tar.gz", hash = "sha256:89b136f677ae65607a84cecda9b4d6c5377b40a97582c504c25df89af16d520e", size = 128095, upload-time = "2026-06-15T22:07:04.003Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0a/38/8c5e72d53ff8eb27497c4f268a7f6d9121e727a50b65248288ad79a93053/python_socketio-5.16.3-py3-none-any.whl", hash = "sha256:e7ad14202a5e6448824c7c2f86161d04e13dec05992257df5c709e6a2798c041", size = 82087, upload-time = "2026-06-15T22:07:02.498Z" }, +] + +[package.optional-dependencies] +asyncio-client = [ + { name = "aiohttp" }, +] + +[[package]] +name = "pythonnet" +version = "3.1.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "clr-loader", marker = "sys_platform == 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/05/57/da1992e44663b71365c6e842c8d7fa453d4ec45fb99a68cfee5b7e944d3c/pythonnet-3.1.0.tar.gz", hash = "sha256:7b34c382905d10a371509ffafd64cae0416305c28817738a9cd138336f4e9991", size = 250599, upload-time = "2026-05-23T20:30:21.578Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ac/4b/52414f442624d2589f5374a48c08d5ae94f24bea67fc13a20a752884e5b7/pythonnet-3.1.0-cp310.cp311.cp312.cp313.cp314-none-any.whl", hash = "sha256:698dd88edc198819ad63b624a6ebe76208c7b46e4fe13626f65e484f0358d6ba", size = 217578, upload-time = "2026-05-23T20:30:19.527Z" }, + { url = "https://files.pythonhosted.org/packages/db/67/031124fdcb937c266a3265118525bbf6dc13b8c79786d6a7290aecb6e7bb/pythonnet-3.1.0-cp310.cp311.cp312.cp313.cp314-none-win32.win_amd64.whl", hash = "sha256:7bdd4de03df3547a48122a3989265c8b31d5be0d19dadffa009eec7df8085e0b", size = 1644898, upload-time = "2026-05-23T20:30:16.213Z" }, +] + +[[package]] +name = "pytz" +version = "2025.2" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/f8/bf/abbd3cdfb8fbc7fb3d4d38d320f2441b1e7cbe29be4f23797b4a2b5d8aac/pytz-2025.2.tar.gz", hash = "sha256:360b9e3dbb49a209c21ad61809c7fb453643e048b38924c765813546746e81c3", size = 320884, upload-time = "2025-03-25T02:25:00.538Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/81/c4/34e93fe5f5429d7570ec1fa436f1986fb1f00c3e0f43a589fe2bbcd22c3f/pytz-2025.2-py2.py3-none-any.whl", hash = "sha256:5ddf76296dd8c44c26eb8f4b6f35488f3ccbf6fbbd7adee0b7262d43f0ec2f00", size = 509225, upload-time = "2025-03-25T02:24:58.468Z" }, +] + +[[package]] +name = "pywebview" +version = "5.4" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "bottle" }, + { name = "proxy-tools" }, + { name = "pyobjc-core", marker = "sys_platform == 'darwin'" }, + { name = "pyobjc-framework-cocoa", marker = "sys_platform == 'darwin'" }, + { name = "pyobjc-framework-quartz", marker = "sys_platform == 'darwin'" }, + { name = "pyobjc-framework-security", marker = "sys_platform == 'darwin'" }, + { name = "pyobjc-framework-webkit", marker = "sys_platform == 'darwin'" }, + { name = "pythonnet", marker = "sys_platform == 'win32'" }, + { name = "qtpy", marker = "sys_platform == 'openbsd6'" }, + { name = "typing-extensions" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/7a/c7/645f3b0bb190bf58c5cea9cfbcaa337ce3b54531ad207d3748676eb8cdc9/pywebview-5.4.tar.gz", hash = "sha256:b5e2c6c7502aaf72a9ae6034daf83785f5fad874fac7fa82bf4fcf854f1f083a", size = 466398, upload-time = "2025-01-27T21:59:05.762Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/4c/5a/7af3b9f8fb51d544b31f2f6c12635eac77d1e9a99f72dd12c9364062d59d/pywebview-5.4-py3-none-any.whl", hash = "sha256:0559c47db543556498dd38604a2a0479896c320f86c9b23499b8e580b58b699d", size = 475504, upload-time = "2025-01-27T21:59:02.459Z" }, +] + +[[package]] +name = "pywin32-ctypes" +version = "0.2.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/85/9f/01a1a99704853cb63f253eea009390c88e7131c67e66a0a02099a8c917cb/pywin32-ctypes-0.2.3.tar.gz", hash = "sha256:d162dc04946d704503b2edc4d55f3dba5c1d539ead017afa00142c38b9885755", size = 29471, upload-time = "2024-08-14T10:15:34.626Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/de/3d/8161f7711c017e01ac9f008dfddd9410dff3674334c233bde66e7ba65bbf/pywin32_ctypes-0.2.3-py3-none-any.whl", hash = "sha256:8a1513379d709975552d202d942d9837758905c8d01eb82b8bcc30918929e7b8", size = 30756, upload-time = "2024-08-14T10:15:33.187Z" }, +] + +[[package]] +name = "pyyaml" +version = "6.0.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/05/8e/961c0007c59b8dd7729d542c61a4d537767a59645b82a0b521206e1e25c2/pyyaml-6.0.3.tar.gz", hash = "sha256:d76623373421df22fb4cf8817020cbb7ef15c725b9d5e45f17e189bfc384190f", size = 130960, upload-time = "2025-09-25T21:33:16.546Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/6d/16/a95b6757765b7b031c9374925bb718d55e0a9ba8a1b6a12d25962ea44347/pyyaml-6.0.3-cp311-cp311-macosx_10_13_x86_64.whl", hash = "sha256:44edc647873928551a01e7a563d7452ccdebee747728c1080d881d68af7b997e", size = 185826, upload-time = "2025-09-25T21:31:58.655Z" }, + { url = "https://files.pythonhosted.org/packages/16/19/13de8e4377ed53079ee996e1ab0a9c33ec2faf808a4647b7b4c0d46dd239/pyyaml-6.0.3-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:652cb6edd41e718550aad172851962662ff2681490a8a711af6a4d288dd96824", size = 175577, upload-time = "2025-09-25T21:32:00.088Z" }, + { url = "https://files.pythonhosted.org/packages/0c/62/d2eb46264d4b157dae1275b573017abec435397aa59cbcdab6fc978a8af4/pyyaml-6.0.3-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:10892704fc220243f5305762e276552a0395f7beb4dbf9b14ec8fd43b57f126c", size = 775556, upload-time = "2025-09-25T21:32:01.31Z" }, + { url = "https://files.pythonhosted.org/packages/10/cb/16c3f2cf3266edd25aaa00d6c4350381c8b012ed6f5276675b9eba8d9ff4/pyyaml-6.0.3-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:850774a7879607d3a6f50d36d04f00ee69e7fc816450e5f7e58d7f17f1ae5c00", size = 882114, upload-time = "2025-09-25T21:32:03.376Z" }, + { url = "https://files.pythonhosted.org/packages/71/60/917329f640924b18ff085ab889a11c763e0b573da888e8404ff486657602/pyyaml-6.0.3-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b8bb0864c5a28024fac8a632c443c87c5aa6f215c0b126c449ae1a150412f31d", size = 806638, upload-time = "2025-09-25T21:32:04.553Z" }, + { url = "https://files.pythonhosted.org/packages/dd/6f/529b0f316a9fd167281a6c3826b5583e6192dba792dd55e3203d3f8e655a/pyyaml-6.0.3-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:1d37d57ad971609cf3c53ba6a7e365e40660e3be0e5175fa9f2365a379d6095a", size = 767463, upload-time = "2025-09-25T21:32:06.152Z" }, + { url = "https://files.pythonhosted.org/packages/f2/6a/b627b4e0c1dd03718543519ffb2f1deea4a1e6d42fbab8021936a4d22589/pyyaml-6.0.3-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:37503bfbfc9d2c40b344d06b2199cf0e96e97957ab1c1b546fd4f87e53e5d3e4", size = 794986, upload-time = "2025-09-25T21:32:07.367Z" }, + { url = "https://files.pythonhosted.org/packages/45/91/47a6e1c42d9ee337c4839208f30d9f09caa9f720ec7582917b264defc875/pyyaml-6.0.3-cp311-cp311-win32.whl", hash = "sha256:8098f252adfa6c80ab48096053f512f2321f0b998f98150cea9bd23d83e1467b", size = 142543, upload-time = "2025-09-25T21:32:08.95Z" }, + { url = "https://files.pythonhosted.org/packages/da/e3/ea007450a105ae919a72393cb06f122f288ef60bba2dc64b26e2646fa315/pyyaml-6.0.3-cp311-cp311-win_amd64.whl", hash = "sha256:9f3bfb4965eb874431221a3ff3fdcddc7e74e3b07799e0e84ca4a0f867d449bf", size = 158763, upload-time = "2025-09-25T21:32:09.96Z" }, + { url = "https://files.pythonhosted.org/packages/d1/33/422b98d2195232ca1826284a76852ad5a86fe23e31b009c9886b2d0fb8b2/pyyaml-6.0.3-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:7f047e29dcae44602496db43be01ad42fc6f1cc0d8cd6c83d342306c32270196", size = 182063, upload-time = "2025-09-25T21:32:11.445Z" }, + { url = "https://files.pythonhosted.org/packages/89/a0/6cf41a19a1f2f3feab0e9c0b74134aa2ce6849093d5517a0c550fe37a648/pyyaml-6.0.3-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:fc09d0aa354569bc501d4e787133afc08552722d3ab34836a80547331bb5d4a0", size = 173973, upload-time = "2025-09-25T21:32:12.492Z" }, + { url = "https://files.pythonhosted.org/packages/ed/23/7a778b6bd0b9a8039df8b1b1d80e2e2ad78aa04171592c8a5c43a56a6af4/pyyaml-6.0.3-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:9149cad251584d5fb4981be1ecde53a1ca46c891a79788c0df828d2f166bda28", size = 775116, upload-time = "2025-09-25T21:32:13.652Z" }, + { url = "https://files.pythonhosted.org/packages/65/30/d7353c338e12baef4ecc1b09e877c1970bd3382789c159b4f89d6a70dc09/pyyaml-6.0.3-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:5fdec68f91a0c6739b380c83b951e2c72ac0197ace422360e6d5a959d8d97b2c", size = 844011, upload-time = "2025-09-25T21:32:15.21Z" }, + { url = "https://files.pythonhosted.org/packages/8b/9d/b3589d3877982d4f2329302ef98a8026e7f4443c765c46cfecc8858c6b4b/pyyaml-6.0.3-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ba1cc08a7ccde2d2ec775841541641e4548226580ab850948cbfda66a1befcdc", size = 807870, upload-time = "2025-09-25T21:32:16.431Z" }, + { url = "https://files.pythonhosted.org/packages/05/c0/b3be26a015601b822b97d9149ff8cb5ead58c66f981e04fedf4e762f4bd4/pyyaml-6.0.3-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:8dc52c23056b9ddd46818a57b78404882310fb473d63f17b07d5c40421e47f8e", size = 761089, upload-time = "2025-09-25T21:32:17.56Z" }, + { url = "https://files.pythonhosted.org/packages/be/8e/98435a21d1d4b46590d5459a22d88128103f8da4c2d4cb8f14f2a96504e1/pyyaml-6.0.3-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:41715c910c881bc081f1e8872880d3c650acf13dfa8214bad49ed4cede7c34ea", size = 790181, upload-time = "2025-09-25T21:32:18.834Z" }, + { url = "https://files.pythonhosted.org/packages/74/93/7baea19427dcfbe1e5a372d81473250b379f04b1bd3c4c5ff825e2327202/pyyaml-6.0.3-cp312-cp312-win32.whl", hash = "sha256:96b533f0e99f6579b3d4d4995707cf36df9100d67e0c8303a0c55b27b5f99bc5", size = 137658, upload-time = "2025-09-25T21:32:20.209Z" }, + { url = "https://files.pythonhosted.org/packages/86/bf/899e81e4cce32febab4fb42bb97dcdf66bc135272882d1987881a4b519e9/pyyaml-6.0.3-cp312-cp312-win_amd64.whl", hash = "sha256:5fcd34e47f6e0b794d17de1b4ff496c00986e1c83f7ab2fb8fcfe9616ff7477b", size = 154003, upload-time = "2025-09-25T21:32:21.167Z" }, + { url = "https://files.pythonhosted.org/packages/1a/08/67bd04656199bbb51dbed1439b7f27601dfb576fb864099c7ef0c3e55531/pyyaml-6.0.3-cp312-cp312-win_arm64.whl", hash = "sha256:64386e5e707d03a7e172c0701abfb7e10f0fb753ee1d773128192742712a98fd", size = 140344, upload-time = "2025-09-25T21:32:22.617Z" }, + { url = "https://files.pythonhosted.org/packages/d1/11/0fd08f8192109f7169db964b5707a2f1e8b745d4e239b784a5a1dd80d1db/pyyaml-6.0.3-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:8da9669d359f02c0b91ccc01cac4a67f16afec0dac22c2ad09f46bee0697eba8", size = 181669, upload-time = "2025-09-25T21:32:23.673Z" }, + { url = "https://files.pythonhosted.org/packages/b1/16/95309993f1d3748cd644e02e38b75d50cbc0d9561d21f390a76242ce073f/pyyaml-6.0.3-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:2283a07e2c21a2aa78d9c4442724ec1eb15f5e42a723b99cb3d822d48f5f7ad1", size = 173252, upload-time = "2025-09-25T21:32:25.149Z" }, + { url = "https://files.pythonhosted.org/packages/50/31/b20f376d3f810b9b2371e72ef5adb33879b25edb7a6d072cb7ca0c486398/pyyaml-6.0.3-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:ee2922902c45ae8ccada2c5b501ab86c36525b883eff4255313a253a3160861c", size = 767081, upload-time = "2025-09-25T21:32:26.575Z" }, + { url = "https://files.pythonhosted.org/packages/49/1e/a55ca81e949270d5d4432fbbd19dfea5321eda7c41a849d443dc92fd1ff7/pyyaml-6.0.3-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:a33284e20b78bd4a18c8c2282d549d10bc8408a2a7ff57653c0cf0b9be0afce5", size = 841159, upload-time = "2025-09-25T21:32:27.727Z" }, + { url = "https://files.pythonhosted.org/packages/74/27/e5b8f34d02d9995b80abcef563ea1f8b56d20134d8f4e5e81733b1feceb2/pyyaml-6.0.3-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:0f29edc409a6392443abf94b9cf89ce99889a1dd5376d94316ae5145dfedd5d6", size = 801626, upload-time = "2025-09-25T21:32:28.878Z" }, + { url = "https://files.pythonhosted.org/packages/f9/11/ba845c23988798f40e52ba45f34849aa8a1f2d4af4b798588010792ebad6/pyyaml-6.0.3-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:f7057c9a337546edc7973c0d3ba84ddcdf0daa14533c2065749c9075001090e6", size = 753613, upload-time = "2025-09-25T21:32:30.178Z" }, + { url = "https://files.pythonhosted.org/packages/3d/e0/7966e1a7bfc0a45bf0a7fb6b98ea03fc9b8d84fa7f2229e9659680b69ee3/pyyaml-6.0.3-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:eda16858a3cab07b80edaf74336ece1f986ba330fdb8ee0d6c0d68fe82bc96be", size = 794115, upload-time = "2025-09-25T21:32:31.353Z" }, + { url = "https://files.pythonhosted.org/packages/de/94/980b50a6531b3019e45ddeada0626d45fa85cbe22300844a7983285bed3b/pyyaml-6.0.3-cp313-cp313-win32.whl", hash = "sha256:d0eae10f8159e8fdad514efdc92d74fd8d682c933a6dd088030f3834bc8e6b26", size = 137427, upload-time = "2025-09-25T21:32:32.58Z" }, + { url = "https://files.pythonhosted.org/packages/97/c9/39d5b874e8b28845e4ec2202b5da735d0199dbe5b8fb85f91398814a9a46/pyyaml-6.0.3-cp313-cp313-win_amd64.whl", hash = "sha256:79005a0d97d5ddabfeeea4cf676af11e647e41d81c9a7722a193022accdb6b7c", size = 154090, upload-time = "2025-09-25T21:32:33.659Z" }, + { url = "https://files.pythonhosted.org/packages/73/e8/2bdf3ca2090f68bb3d75b44da7bbc71843b19c9f2b9cb9b0f4ab7a5a4329/pyyaml-6.0.3-cp313-cp313-win_arm64.whl", hash = "sha256:5498cd1645aa724a7c71c8f378eb29ebe23da2fc0d7a08071d89469bf1d2defb", size = 140246, upload-time = "2025-09-25T21:32:34.663Z" }, + { url = "https://files.pythonhosted.org/packages/9d/8c/f4bd7f6465179953d3ac9bc44ac1a8a3e6122cf8ada906b4f96c60172d43/pyyaml-6.0.3-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:8d1fab6bb153a416f9aeb4b8763bc0f22a5586065f86f7664fc23339fc1c1fac", size = 181814, upload-time = "2025-09-25T21:32:35.712Z" }, + { url = "https://files.pythonhosted.org/packages/bd/9c/4d95bb87eb2063d20db7b60faa3840c1b18025517ae857371c4dd55a6b3a/pyyaml-6.0.3-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:34d5fcd24b8445fadc33f9cf348c1047101756fd760b4dacb5c3e99755703310", size = 173809, upload-time = "2025-09-25T21:32:36.789Z" }, + { url = "https://files.pythonhosted.org/packages/92/b5/47e807c2623074914e29dabd16cbbdd4bf5e9b2db9f8090fa64411fc5382/pyyaml-6.0.3-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:501a031947e3a9025ed4405a168e6ef5ae3126c59f90ce0cd6f2bfc477be31b7", size = 766454, upload-time = "2025-09-25T21:32:37.966Z" }, + { url = "https://files.pythonhosted.org/packages/02/9e/e5e9b168be58564121efb3de6859c452fccde0ab093d8438905899a3a483/pyyaml-6.0.3-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:b3bc83488de33889877a0f2543ade9f70c67d66d9ebb4ac959502e12de895788", size = 836355, upload-time = "2025-09-25T21:32:39.178Z" }, + { url = "https://files.pythonhosted.org/packages/88/f9/16491d7ed2a919954993e48aa941b200f38040928474c9e85ea9e64222c3/pyyaml-6.0.3-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:c458b6d084f9b935061bc36216e8a69a7e293a2f1e68bf956dcd9e6cbcd143f5", size = 794175, upload-time = "2025-09-25T21:32:40.865Z" }, + { url = "https://files.pythonhosted.org/packages/dd/3f/5989debef34dc6397317802b527dbbafb2b4760878a53d4166579111411e/pyyaml-6.0.3-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:7c6610def4f163542a622a73fb39f534f8c101d690126992300bf3207eab9764", size = 755228, upload-time = "2025-09-25T21:32:42.084Z" }, + { url = "https://files.pythonhosted.org/packages/d7/ce/af88a49043cd2e265be63d083fc75b27b6ed062f5f9fd6cdc223ad62f03e/pyyaml-6.0.3-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:5190d403f121660ce8d1d2c1bb2ef1bd05b5f68533fc5c2ea899bd15f4399b35", size = 789194, upload-time = "2025-09-25T21:32:43.362Z" }, + { url = "https://files.pythonhosted.org/packages/23/20/bb6982b26a40bb43951265ba29d4c246ef0ff59c9fdcdf0ed04e0687de4d/pyyaml-6.0.3-cp314-cp314-win_amd64.whl", hash = "sha256:4a2e8cebe2ff6ab7d1050ecd59c25d4c8bd7e6f400f5f82b96557ac0abafd0ac", size = 156429, upload-time = "2025-09-25T21:32:57.844Z" }, + { url = "https://files.pythonhosted.org/packages/f4/f4/a4541072bb9422c8a883ab55255f918fa378ecf083f5b85e87fc2b4eda1b/pyyaml-6.0.3-cp314-cp314-win_arm64.whl", hash = "sha256:93dda82c9c22deb0a405ea4dc5f2d0cda384168e466364dec6255b293923b2f3", size = 143912, upload-time = "2025-09-25T21:32:59.247Z" }, + { url = "https://files.pythonhosted.org/packages/7c/f9/07dd09ae774e4616edf6cda684ee78f97777bdd15847253637a6f052a62f/pyyaml-6.0.3-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:02893d100e99e03eda1c8fd5c441d8c60103fd175728e23e431db1b589cf5ab3", size = 189108, upload-time = "2025-09-25T21:32:44.377Z" }, + { url = "https://files.pythonhosted.org/packages/4e/78/8d08c9fb7ce09ad8c38ad533c1191cf27f7ae1effe5bb9400a46d9437fcf/pyyaml-6.0.3-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:c1ff362665ae507275af2853520967820d9124984e0f7466736aea23d8611fba", size = 183641, upload-time = "2025-09-25T21:32:45.407Z" }, + { url = "https://files.pythonhosted.org/packages/7b/5b/3babb19104a46945cf816d047db2788bcaf8c94527a805610b0289a01c6b/pyyaml-6.0.3-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6adc77889b628398debc7b65c073bcb99c4a0237b248cacaf3fe8a557563ef6c", size = 831901, upload-time = "2025-09-25T21:32:48.83Z" }, + { url = "https://files.pythonhosted.org/packages/8b/cc/dff0684d8dc44da4d22a13f35f073d558c268780ce3c6ba1b87055bb0b87/pyyaml-6.0.3-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:a80cb027f6b349846a3bf6d73b5e95e782175e52f22108cfa17876aaeff93702", size = 861132, upload-time = "2025-09-25T21:32:50.149Z" }, + { url = "https://files.pythonhosted.org/packages/b1/5e/f77dc6b9036943e285ba76b49e118d9ea929885becb0a29ba8a7c75e29fe/pyyaml-6.0.3-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:00c4bdeba853cc34e7dd471f16b4114f4162dc03e6b7afcc2128711f0eca823c", size = 839261, upload-time = "2025-09-25T21:32:51.808Z" }, + { url = "https://files.pythonhosted.org/packages/ce/88/a9db1376aa2a228197c58b37302f284b5617f56a5d959fd1763fb1675ce6/pyyaml-6.0.3-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:66e1674c3ef6f541c35191caae2d429b967b99e02040f5ba928632d9a7f0f065", size = 805272, upload-time = "2025-09-25T21:32:52.941Z" }, + { url = "https://files.pythonhosted.org/packages/da/92/1446574745d74df0c92e6aa4a7b0b3130706a4142b2d1a5869f2eaa423c6/pyyaml-6.0.3-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:16249ee61e95f858e83976573de0f5b2893b3677ba71c9dd36b9cf8be9ac6d65", size = 829923, upload-time = "2025-09-25T21:32:54.537Z" }, + { url = "https://files.pythonhosted.org/packages/f0/7a/1c7270340330e575b92f397352af856a8c06f230aa3e76f86b39d01b416a/pyyaml-6.0.3-cp314-cp314t-win_amd64.whl", hash = "sha256:4ad1906908f2f5ae4e5a8ddfce73c320c2a1429ec52eafd27138b7f1cbe341c9", size = 174062, upload-time = "2025-09-25T21:32:55.767Z" }, + { url = "https://files.pythonhosted.org/packages/f1/12/de94a39c2ef588c7e6455cfbe7343d3b2dc9d6b6b2f40c4c6565744c873d/pyyaml-6.0.3-cp314-cp314t-win_arm64.whl", hash = "sha256:ebc55a14a21cb14062aa4162f906cd962b28e2e9ea38f9b4391244cd8de4ae0b", size = 149341, upload-time = "2025-09-25T21:32:56.828Z" }, +] + +[[package]] +name = "pyzmq" +version = "27.1.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "cffi", marker = "implementation_name == 'pypy'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/04/0b/3c9baedbdf613ecaa7aa07027780b8867f57b6293b6ee50de316c9f3222b/pyzmq-27.1.0.tar.gz", hash = "sha256:ac0765e3d44455adb6ddbf4417dcce460fc40a05978c08efdf2948072f6db540", size = 281750, upload-time = "2025-09-08T23:10:18.157Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/06/5d/305323ba86b284e6fcb0d842d6adaa2999035f70f8c38a9b6d21ad28c3d4/pyzmq-27.1.0-cp311-cp311-macosx_10_15_universal2.whl", hash = "sha256:226b091818d461a3bef763805e75685e478ac17e9008f49fce2d3e52b3d58b86", size = 1333328, upload-time = "2025-09-08T23:07:45.946Z" }, + { url = "https://files.pythonhosted.org/packages/bd/a0/fc7e78a23748ad5443ac3275943457e8452da67fda347e05260261108cbc/pyzmq-27.1.0-cp311-cp311-manylinux2014_i686.manylinux_2_17_i686.whl", hash = "sha256:0790a0161c281ca9723f804871b4027f2e8b5a528d357c8952d08cd1a9c15581", size = 908803, upload-time = "2025-09-08T23:07:47.551Z" }, + { url = "https://files.pythonhosted.org/packages/7e/22/37d15eb05f3bdfa4abea6f6d96eb3bb58585fbd3e4e0ded4e743bc650c97/pyzmq-27.1.0-cp311-cp311-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:c895a6f35476b0c3a54e3eb6ccf41bf3018de937016e6e18748317f25d4e925f", size = 668836, upload-time = "2025-09-08T23:07:49.436Z" }, + { url = "https://files.pythonhosted.org/packages/b1/c4/2a6fe5111a01005fc7af3878259ce17684fabb8852815eda6225620f3c59/pyzmq-27.1.0-cp311-cp311-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:5bbf8d3630bf96550b3be8e1fc0fea5cbdc8d5466c1192887bd94869da17a63e", size = 857038, upload-time = "2025-09-08T23:07:51.234Z" }, + { url = "https://files.pythonhosted.org/packages/cb/eb/bfdcb41d0db9cd233d6fb22dc131583774135505ada800ebf14dfb0a7c40/pyzmq-27.1.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:15c8bd0fe0dabf808e2d7a681398c4e5ded70a551ab47482067a572c054c8e2e", size = 1657531, upload-time = "2025-09-08T23:07:52.795Z" }, + { url = "https://files.pythonhosted.org/packages/ab/21/e3180ca269ed4a0de5c34417dfe71a8ae80421198be83ee619a8a485b0c7/pyzmq-27.1.0-cp311-cp311-musllinux_1_2_i686.whl", hash = "sha256:bafcb3dd171b4ae9f19ee6380dfc71ce0390fefaf26b504c0e5f628d7c8c54f2", size = 2034786, upload-time = "2025-09-08T23:07:55.047Z" }, + { url = "https://files.pythonhosted.org/packages/3b/b1/5e21d0b517434b7f33588ff76c177c5a167858cc38ef740608898cd329f2/pyzmq-27.1.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:e829529fcaa09937189178115c49c504e69289abd39967cd8a4c215761373394", size = 1894220, upload-time = "2025-09-08T23:07:57.172Z" }, + { url = "https://files.pythonhosted.org/packages/03/f2/44913a6ff6941905efc24a1acf3d3cb6146b636c546c7406c38c49c403d4/pyzmq-27.1.0-cp311-cp311-win32.whl", hash = "sha256:6df079c47d5902af6db298ec92151db82ecb557af663098b92f2508c398bb54f", size = 567155, upload-time = "2025-09-08T23:07:59.05Z" }, + { url = "https://files.pythonhosted.org/packages/23/6d/d8d92a0eb270a925c9b4dd039c0b4dc10abc2fcbc48331788824ef113935/pyzmq-27.1.0-cp311-cp311-win_amd64.whl", hash = "sha256:190cbf120fbc0fc4957b56866830def56628934a9d112aec0e2507aa6a032b97", size = 633428, upload-time = "2025-09-08T23:08:00.663Z" }, + { url = "https://files.pythonhosted.org/packages/ae/14/01afebc96c5abbbd713ecfc7469cfb1bc801c819a74ed5c9fad9a48801cb/pyzmq-27.1.0-cp311-cp311-win_arm64.whl", hash = "sha256:eca6b47df11a132d1745eb3b5b5e557a7dae2c303277aa0e69c6ba91b8736e07", size = 559497, upload-time = "2025-09-08T23:08:02.15Z" }, + { url = "https://files.pythonhosted.org/packages/92/e7/038aab64a946d535901103da16b953c8c9cc9c961dadcbf3609ed6428d23/pyzmq-27.1.0-cp312-abi3-macosx_10_15_universal2.whl", hash = "sha256:452631b640340c928fa343801b0d07eb0c3789a5ffa843f6e1a9cee0ba4eb4fc", size = 1306279, upload-time = "2025-09-08T23:08:03.807Z" }, + { url = "https://files.pythonhosted.org/packages/e8/5e/c3c49fdd0f535ef45eefcc16934648e9e59dace4a37ee88fc53f6cd8e641/pyzmq-27.1.0-cp312-abi3-manylinux2014_i686.manylinux_2_17_i686.whl", hash = "sha256:1c179799b118e554b66da67d88ed66cd37a169f1f23b5d9f0a231b4e8d44a113", size = 895645, upload-time = "2025-09-08T23:08:05.301Z" }, + { url = "https://files.pythonhosted.org/packages/f8/e5/b0b2504cb4e903a74dcf1ebae157f9e20ebb6ea76095f6cfffea28c42ecd/pyzmq-27.1.0-cp312-abi3-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:3837439b7f99e60312f0c926a6ad437b067356dc2bc2ec96eb395fd0fe804233", size = 652574, upload-time = "2025-09-08T23:08:06.828Z" }, + { url = "https://files.pythonhosted.org/packages/f8/9b/c108cdb55560eaf253f0cbdb61b29971e9fb34d9c3499b0e96e4e60ed8a5/pyzmq-27.1.0-cp312-abi3-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:43ad9a73e3da1fab5b0e7e13402f0b2fb934ae1c876c51d0afff0e7c052eca31", size = 840995, upload-time = "2025-09-08T23:08:08.396Z" }, + { url = "https://files.pythonhosted.org/packages/c2/bb/b79798ca177b9eb0825b4c9998c6af8cd2a7f15a6a1a4272c1d1a21d382f/pyzmq-27.1.0-cp312-abi3-musllinux_1_2_aarch64.whl", hash = "sha256:0de3028d69d4cdc475bfe47a6128eb38d8bc0e8f4d69646adfbcd840facbac28", size = 1642070, upload-time = "2025-09-08T23:08:09.989Z" }, + { url = "https://files.pythonhosted.org/packages/9c/80/2df2e7977c4ede24c79ae39dcef3899bfc5f34d1ca7a5b24f182c9b7a9ca/pyzmq-27.1.0-cp312-abi3-musllinux_1_2_i686.whl", hash = "sha256:cf44a7763aea9298c0aa7dbf859f87ed7012de8bda0f3977b6fb1d96745df856", size = 2021121, upload-time = "2025-09-08T23:08:11.907Z" }, + { url = "https://files.pythonhosted.org/packages/46/bd/2d45ad24f5f5ae7e8d01525eb76786fa7557136555cac7d929880519e33a/pyzmq-27.1.0-cp312-abi3-musllinux_1_2_x86_64.whl", hash = "sha256:f30f395a9e6fbca195400ce833c731e7b64c3919aa481af4d88c3759e0cb7496", size = 1878550, upload-time = "2025-09-08T23:08:13.513Z" }, + { url = "https://files.pythonhosted.org/packages/e6/2f/104c0a3c778d7c2ab8190e9db4f62f0b6957b53c9d87db77c284b69f33ea/pyzmq-27.1.0-cp312-abi3-win32.whl", hash = "sha256:250e5436a4ba13885494412b3da5d518cd0d3a278a1ae640e113c073a5f88edd", size = 559184, upload-time = "2025-09-08T23:08:15.163Z" }, + { url = "https://files.pythonhosted.org/packages/fc/7f/a21b20d577e4100c6a41795842028235998a643b1ad406a6d4163ea8f53e/pyzmq-27.1.0-cp312-abi3-win_amd64.whl", hash = "sha256:9ce490cf1d2ca2ad84733aa1d69ce6855372cb5ce9223802450c9b2a7cba0ccf", size = 619480, upload-time = "2025-09-08T23:08:17.192Z" }, + { url = "https://files.pythonhosted.org/packages/78/c2/c012beae5f76b72f007a9e91ee9401cb88c51d0f83c6257a03e785c81cc2/pyzmq-27.1.0-cp312-abi3-win_arm64.whl", hash = "sha256:75a2f36223f0d535a0c919e23615fc85a1e23b71f40c7eb43d7b1dedb4d8f15f", size = 552993, upload-time = "2025-09-08T23:08:18.926Z" }, + { url = "https://files.pythonhosted.org/packages/60/cb/84a13459c51da6cec1b7b1dc1a47e6db6da50b77ad7fd9c145842750a011/pyzmq-27.1.0-cp313-cp313-android_24_arm64_v8a.whl", hash = "sha256:93ad4b0855a664229559e45c8d23797ceac03183c7b6f5b4428152a6b06684a5", size = 1122436, upload-time = "2025-09-08T23:08:20.801Z" }, + { url = "https://files.pythonhosted.org/packages/dc/b6/94414759a69a26c3dd674570a81813c46a078767d931a6c70ad29fc585cb/pyzmq-27.1.0-cp313-cp313-android_24_x86_64.whl", hash = "sha256:fbb4f2400bfda24f12f009cba62ad5734148569ff4949b1b6ec3b519444342e6", size = 1156301, upload-time = "2025-09-08T23:08:22.47Z" }, + { url = "https://files.pythonhosted.org/packages/a5/ad/15906493fd40c316377fd8a8f6b1f93104f97a752667763c9b9c1b71d42d/pyzmq-27.1.0-cp313-cp313t-macosx_10_15_universal2.whl", hash = "sha256:e343d067f7b151cfe4eb3bb796a7752c9d369eed007b91231e817071d2c2fec7", size = 1341197, upload-time = "2025-09-08T23:08:24.286Z" }, + { url = "https://files.pythonhosted.org/packages/14/1d/d343f3ce13db53a54cb8946594e567410b2125394dafcc0268d8dda027e0/pyzmq-27.1.0-cp313-cp313t-manylinux2014_i686.manylinux_2_17_i686.whl", hash = "sha256:08363b2011dec81c354d694bdecaef4770e0ae96b9afea70b3f47b973655cc05", size = 897275, upload-time = "2025-09-08T23:08:26.063Z" }, + { url = "https://files.pythonhosted.org/packages/69/2d/d83dd6d7ca929a2fc67d2c3005415cdf322af7751d773524809f9e585129/pyzmq-27.1.0-cp313-cp313t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:d54530c8c8b5b8ddb3318f481297441af102517602b569146185fa10b63f4fa9", size = 660469, upload-time = "2025-09-08T23:08:27.623Z" }, + { url = "https://files.pythonhosted.org/packages/3e/cd/9822a7af117f4bc0f1952dbe9ef8358eb50a24928efd5edf54210b850259/pyzmq-27.1.0-cp313-cp313t-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6f3afa12c392f0a44a2414056d730eebc33ec0926aae92b5ad5cf26ebb6cc128", size = 847961, upload-time = "2025-09-08T23:08:29.672Z" }, + { url = "https://files.pythonhosted.org/packages/9a/12/f003e824a19ed73be15542f172fd0ec4ad0b60cf37436652c93b9df7c585/pyzmq-27.1.0-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:c65047adafe573ff023b3187bb93faa583151627bc9c51fc4fb2c561ed689d39", size = 1650282, upload-time = "2025-09-08T23:08:31.349Z" }, + { url = "https://files.pythonhosted.org/packages/d5/4a/e82d788ed58e9a23995cee70dbc20c9aded3d13a92d30d57ec2291f1e8a3/pyzmq-27.1.0-cp313-cp313t-musllinux_1_2_i686.whl", hash = "sha256:90e6e9441c946a8b0a667356f7078d96411391a3b8f80980315455574177ec97", size = 2024468, upload-time = "2025-09-08T23:08:33.543Z" }, + { url = "https://files.pythonhosted.org/packages/d9/94/2da0a60841f757481e402b34bf4c8bf57fa54a5466b965de791b1e6f747d/pyzmq-27.1.0-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:add071b2d25f84e8189aaf0882d39a285b42fa3853016ebab234a5e78c7a43db", size = 1885394, upload-time = "2025-09-08T23:08:35.51Z" }, + { url = "https://files.pythonhosted.org/packages/4f/6f/55c10e2e49ad52d080dc24e37adb215e5b0d64990b57598abc2e3f01725b/pyzmq-27.1.0-cp313-cp313t-win32.whl", hash = "sha256:7ccc0700cfdf7bd487bea8d850ec38f204478681ea02a582a8da8171b7f90a1c", size = 574964, upload-time = "2025-09-08T23:08:37.178Z" }, + { url = "https://files.pythonhosted.org/packages/87/4d/2534970ba63dd7c522d8ca80fb92777f362c0f321900667c615e2067cb29/pyzmq-27.1.0-cp313-cp313t-win_amd64.whl", hash = "sha256:8085a9fba668216b9b4323be338ee5437a235fe275b9d1610e422ccc279733e2", size = 641029, upload-time = "2025-09-08T23:08:40.595Z" }, + { url = "https://files.pythonhosted.org/packages/f6/fa/f8aea7a28b0641f31d40dea42d7ef003fded31e184ef47db696bc74cd610/pyzmq-27.1.0-cp313-cp313t-win_arm64.whl", hash = "sha256:6bb54ca21bcfe361e445256c15eedf083f153811c37be87e0514934d6913061e", size = 561541, upload-time = "2025-09-08T23:08:42.668Z" }, + { url = "https://files.pythonhosted.org/packages/87/45/19efbb3000956e82d0331bafca5d9ac19ea2857722fa2caacefb6042f39d/pyzmq-27.1.0-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:ce980af330231615756acd5154f29813d553ea555485ae712c491cd483df6b7a", size = 1341197, upload-time = "2025-09-08T23:08:44.973Z" }, + { url = "https://files.pythonhosted.org/packages/48/43/d72ccdbf0d73d1343936296665826350cb1e825f92f2db9db3e61c2162a2/pyzmq-27.1.0-cp314-cp314t-manylinux2014_i686.manylinux_2_17_i686.whl", hash = "sha256:1779be8c549e54a1c38f805e56d2a2e5c009d26de10921d7d51cfd1c8d4632ea", size = 897175, upload-time = "2025-09-08T23:08:46.601Z" }, + { url = "https://files.pythonhosted.org/packages/2f/2e/a483f73a10b65a9ef0161e817321d39a770b2acf8bcf3004a28d90d14a94/pyzmq-27.1.0-cp314-cp314t-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:7200bb0f03345515df50d99d3db206a0a6bee1955fbb8c453c76f5bf0e08fb96", size = 660427, upload-time = "2025-09-08T23:08:48.187Z" }, + { url = "https://files.pythonhosted.org/packages/f5/d2/5f36552c2d3e5685abe60dfa56f91169f7a2d99bbaf67c5271022ab40863/pyzmq-27.1.0-cp314-cp314t-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:01c0e07d558b06a60773744ea6251f769cd79a41a97d11b8bf4ab8f034b0424d", size = 847929, upload-time = "2025-09-08T23:08:49.76Z" }, + { url = "https://files.pythonhosted.org/packages/c4/2a/404b331f2b7bf3198e9945f75c4c521f0c6a3a23b51f7a4a401b94a13833/pyzmq-27.1.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:80d834abee71f65253c91540445d37c4c561e293ba6e741b992f20a105d69146", size = 1650193, upload-time = "2025-09-08T23:08:51.7Z" }, + { url = "https://files.pythonhosted.org/packages/1c/0b/f4107e33f62a5acf60e3ded67ed33d79b4ce18de432625ce2fc5093d6388/pyzmq-27.1.0-cp314-cp314t-musllinux_1_2_i686.whl", hash = "sha256:544b4e3b7198dde4a62b8ff6685e9802a9a1ebf47e77478a5eb88eca2a82f2fd", size = 2024388, upload-time = "2025-09-08T23:08:53.393Z" }, + { url = "https://files.pythonhosted.org/packages/0d/01/add31fe76512642fd6e40e3a3bd21f4b47e242c8ba33efb6809e37076d9b/pyzmq-27.1.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:cedc4c68178e59a4046f97eca31b148ddcf51e88677de1ef4e78cf06c5376c9a", size = 1885316, upload-time = "2025-09-08T23:08:55.702Z" }, + { url = "https://files.pythonhosted.org/packages/c4/59/a5f38970f9bf07cee96128de79590bb354917914a9be11272cfc7ff26af0/pyzmq-27.1.0-cp314-cp314t-win32.whl", hash = "sha256:1f0b2a577fd770aa6f053211a55d1c47901f4d537389a034c690291485e5fe92", size = 587472, upload-time = "2025-09-08T23:08:58.18Z" }, + { url = "https://files.pythonhosted.org/packages/70/d8/78b1bad170f93fcf5e3536e70e8fadac55030002275c9a29e8f5719185de/pyzmq-27.1.0-cp314-cp314t-win_amd64.whl", hash = "sha256:19c9468ae0437f8074af379e986c5d3d7d7bfe033506af442e8c879732bedbe0", size = 661401, upload-time = "2025-09-08T23:08:59.802Z" }, + { url = "https://files.pythonhosted.org/packages/81/d6/4bfbb40c9a0b42fc53c7cf442f6385db70b40f74a783130c5d0a5aa62228/pyzmq-27.1.0-cp314-cp314t-win_arm64.whl", hash = "sha256:dc5dbf68a7857b59473f7df42650c621d7e8923fb03fa74a526890f4d33cc4d7", size = 575170, upload-time = "2025-09-08T23:09:01.418Z" }, + { url = "https://files.pythonhosted.org/packages/4c/c6/c4dcdecdbaa70969ee1fdced6d7b8f60cfabe64d25361f27ac4665a70620/pyzmq-27.1.0-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:18770c8d3563715387139060d37859c02ce40718d1faf299abddcdcc6a649066", size = 836265, upload-time = "2025-09-08T23:09:49.376Z" }, + { url = "https://files.pythonhosted.org/packages/3e/79/f38c92eeaeb03a2ccc2ba9866f0439593bb08c5e3b714ac1d553e5c96e25/pyzmq-27.1.0-pp311-pypy311_pp73-manylinux2014_i686.manylinux_2_17_i686.whl", hash = "sha256:ac25465d42f92e990f8d8b0546b01c391ad431c3bf447683fdc40565941d0604", size = 800208, upload-time = "2025-09-08T23:09:51.073Z" }, + { url = "https://files.pythonhosted.org/packages/49/0e/3f0d0d335c6b3abb9b7b723776d0b21fa7f3a6c819a0db6097059aada160/pyzmq-27.1.0-pp311-pypy311_pp73-manylinux_2_26_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:53b40f8ae006f2734ee7608d59ed661419f087521edbfc2149c3932e9c14808c", size = 567747, upload-time = "2025-09-08T23:09:52.698Z" }, + { url = "https://files.pythonhosted.org/packages/a1/cf/f2b3784d536250ffd4be70e049f3b60981235d70c6e8ce7e3ef21e1adb25/pyzmq-27.1.0-pp311-pypy311_pp73-manylinux_2_26_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:f605d884e7c8be8fe1aa94e0a783bf3f591b84c24e4bc4f3e7564c82ac25e271", size = 747371, upload-time = "2025-09-08T23:09:54.563Z" }, + { url = "https://files.pythonhosted.org/packages/01/1b/5dbe84eefc86f48473947e2f41711aded97eecef1231f4558f1f02713c12/pyzmq-27.1.0-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:c9f7f6e13dff2e44a6afeaf2cf54cee5929ad64afaf4d40b50f93c58fc687355", size = 544862, upload-time = "2025-09-08T23:09:56.509Z" }, +] + +[[package]] +name = "qtpy" +version = "2.4.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "packaging", marker = "sys_platform != 'emscripten' and sys_platform != 'win32'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/70/01/392eba83c8e47b946b929d7c46e0f04b35e9671f8bb6fc36b6f7945b4de8/qtpy-2.4.3.tar.gz", hash = "sha256:db744f7832e6d3da90568ba6ccbca3ee2b3b4a890c3d6fbbc63142f6e4cdf5bb", size = 66982, upload-time = "2025-02-11T15:09:25.759Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/69/76/37c0ccd5ab968a6a438f9c623aeecc84c202ab2fabc6a8fd927580c15b5a/QtPy-2.4.3-py3-none-any.whl", hash = "sha256:72095afe13673e017946cc258b8d5da43314197b741ed2890e563cf384b51aa1", size = 95045, upload-time = "2025-02-11T15:09:24.162Z" }, +] + +[[package]] +name = "requests" +version = "2.32.5" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "certifi" }, + { name = "charset-normalizer" }, + { name = "idna" }, + { name = "urllib3" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/c9/74/b3ff8e6c8446842c3f5c837e9c3dfcfe2018ea6ecef224c710c85ef728f4/requests-2.32.5.tar.gz", hash = "sha256:dbba0bac56e100853db0ea71b82b4dfd5fe2bf6d3754a8893c3af500cec7d7cf", size = 134517, upload-time = "2025-08-18T20:46:02.573Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1e/db/4254e3eabe8020b458f1a747140d32277ec7a271daf1d235b70dc0b4e6e3/requests-2.32.5-py3-none-any.whl", hash = "sha256:2462f94637a34fd532264295e186976db0f5d453d1cdd31473c85a6a161affb6", size = 64738, upload-time = "2025-08-18T20:46:00.542Z" }, +] + +[[package]] +name = "rich" +version = "14.3.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "markdown-it-py" }, + { name = "pygments" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/74/99/a4cab2acbb884f80e558b0771e97e21e939c5dfb460f488d19df485e8298/rich-14.3.2.tar.gz", hash = "sha256:e712f11c1a562a11843306f5ed999475f09ac31ffb64281f73ab29ffdda8b3b8", size = 230143, upload-time = "2026-02-01T16:20:47.908Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ef/45/615f5babd880b4bd7d405cc0dc348234c5ffb6ed1ea33e152ede08b2072d/rich-14.3.2-py3-none-any.whl", hash = "sha256:08e67c3e90884651da3239ea668222d19bea7b589149d8014a21c633420dbb69", size = 309963, upload-time = "2026-02-01T16:20:46.078Z" }, +] + +[[package]] +name = "roman-numerals" +version = "4.1.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ae/f9/41dc953bbeb056c17d5f7a519f50fdf010bd0553be2d630bc69d1e022703/roman_numerals-4.1.0.tar.gz", hash = "sha256:1af8b147eb1405d5839e78aeb93131690495fe9da5c91856cb33ad55a7f1e5b2", size = 9077, upload-time = "2025-12-17T18:25:34.381Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/04/54/6f679c435d28e0a568d8e8a7c0a93a09010818634c3c3907fc98d8983770/roman_numerals-4.1.0-py3-none-any.whl", hash = "sha256:647ba99caddc2cc1e55a51e4360689115551bf4476d90e8162cf8c345fe233c7", size = 7676, upload-time = "2025-12-17T18:25:33.098Z" }, +] + +[[package]] +name = "ruff" +version = "0.15.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/04/dc/4e6ac71b511b141cf626357a3946679abeba4cf67bc7cc5a17920f31e10d/ruff-0.15.1.tar.gz", hash = "sha256:c590fe13fb57c97141ae975c03a1aedb3d3156030cabd740d6ff0b0d601e203f", size = 4540855, upload-time = "2026-02-12T23:09:09.998Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/23/bf/e6e4324238c17f9d9120a9d60aa99a7daaa21204c07fcd84e2ef03bb5fd1/ruff-0.15.1-py3-none-linux_armv6l.whl", hash = "sha256:b101ed7cf4615bda6ffe65bdb59f964e9f4a0d3f85cbf0e54f0ab76d7b90228a", size = 10367819, upload-time = "2026-02-12T23:09:03.598Z" }, + { url = "https://files.pythonhosted.org/packages/b3/ea/c8f89d32e7912269d38c58f3649e453ac32c528f93bb7f4219258be2e7ed/ruff-0.15.1-py3-none-macosx_10_12_x86_64.whl", hash = "sha256:939c995e9277e63ea632cc8d3fae17aa758526f49a9a850d2e7e758bfef46602", size = 10798618, upload-time = "2026-02-12T23:09:22.928Z" }, + { url = "https://files.pythonhosted.org/packages/5e/0f/1d0d88bc862624247d82c20c10d4c0f6bb2f346559d8af281674cf327f15/ruff-0.15.1-py3-none-macosx_11_0_arm64.whl", hash = "sha256:1d83466455fdefe60b8d9c8df81d3c1bbb2115cede53549d3b522ce2bc703899", size = 10148518, upload-time = "2026-02-12T23:08:58.339Z" }, + { url = "https://files.pythonhosted.org/packages/f5/c8/291c49cefaa4a9248e986256df2ade7add79388fe179e0691be06fae6f37/ruff-0.15.1-py3-none-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:a9457e3c3291024866222b96108ab2d8265b477e5b1534c7ddb1810904858d16", size = 10518811, upload-time = "2026-02-12T23:09:31.865Z" }, + { url = "https://files.pythonhosted.org/packages/c3/1a/f5707440e5ae43ffa5365cac8bbb91e9665f4a883f560893829cf16a606b/ruff-0.15.1-py3-none-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:92c92b003e9d4f7fbd33b1867bb15a1b785b1735069108dfc23821ba045b29bc", size = 10196169, upload-time = "2026-02-12T23:09:17.306Z" }, + { url = "https://files.pythonhosted.org/packages/2a/ff/26ddc8c4da04c8fd3ee65a89c9fb99eaa5c30394269d424461467be2271f/ruff-0.15.1-py3-none-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:1fe5c41ab43e3a06778844c586251eb5a510f67125427625f9eb2b9526535779", size = 10990491, upload-time = "2026-02-12T23:09:25.503Z" }, + { url = "https://files.pythonhosted.org/packages/fc/00/50920cb385b89413f7cdb4bb9bc8fc59c1b0f30028d8bccc294189a54955/ruff-0.15.1-py3-none-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:66a6dd6df4d80dc382c6484f8ce1bcceb55c32e9f27a8b94c32f6c7331bf14fb", size = 11843280, upload-time = "2026-02-12T23:09:19.88Z" }, + { url = "https://files.pythonhosted.org/packages/5d/6d/2f5cad8380caf5632a15460c323ae326f1e1a2b5b90a6ee7519017a017ca/ruff-0.15.1-py3-none-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:6a4a42cbb8af0bda9bcd7606b064d7c0bc311a88d141d02f78920be6acb5aa83", size = 11274336, upload-time = "2026-02-12T23:09:14.907Z" }, + { url = "https://files.pythonhosted.org/packages/a3/1d/5f56cae1d6c40b8a318513599b35ea4b075d7dc1cd1d04449578c29d1d75/ruff-0.15.1-py3-none-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:4ab064052c31dddada35079901592dfba2e05f5b1e43af3954aafcbc1096a5b2", size = 11137288, upload-time = "2026-02-12T23:09:07.475Z" }, + { url = "https://files.pythonhosted.org/packages/cd/20/6f8d7d8f768c93b0382b33b9306b3b999918816da46537d5a61635514635/ruff-0.15.1-py3-none-manylinux_2_31_riscv64.whl", hash = "sha256:5631c940fe9fe91f817a4c2ea4e81f47bee3ca4aa646134a24374f3c19ad9454", size = 11070681, upload-time = "2026-02-12T23:08:55.43Z" }, + { url = "https://files.pythonhosted.org/packages/9a/67/d640ac76069f64cdea59dba02af2e00b1fa30e2103c7f8d049c0cff4cafd/ruff-0.15.1-py3-none-musllinux_1_2_aarch64.whl", hash = "sha256:68138a4ba184b4691ccdc39f7795c66b3c68160c586519e7e8444cf5a53e1b4c", size = 10486401, upload-time = "2026-02-12T23:09:27.927Z" }, + { url = "https://files.pythonhosted.org/packages/65/3d/e1429f64a3ff89297497916b88c32a5cc88eeca7e9c787072d0e7f1d3e1e/ruff-0.15.1-py3-none-musllinux_1_2_armv7l.whl", hash = "sha256:518f9af03bfc33c03bdb4cb63fabc935341bb7f54af500f92ac309ecfbba6330", size = 10197452, upload-time = "2026-02-12T23:09:12.147Z" }, + { url = "https://files.pythonhosted.org/packages/78/83/e2c3bade17dad63bf1e1c2ffaf11490603b760be149e1419b07049b36ef2/ruff-0.15.1-py3-none-musllinux_1_2_i686.whl", hash = "sha256:da79f4d6a826caaea95de0237a67e33b81e6ec2e25fc7e1993a4015dffca7c61", size = 10693900, upload-time = "2026-02-12T23:09:34.418Z" }, + { url = "https://files.pythonhosted.org/packages/a1/27/fdc0e11a813e6338e0706e8b39bb7a1d61ea5b36873b351acee7e524a72a/ruff-0.15.1-py3-none-musllinux_1_2_x86_64.whl", hash = "sha256:3dd86dccb83cd7d4dcfac303ffc277e6048600dfc22e38158afa208e8bf94a1f", size = 11227302, upload-time = "2026-02-12T23:09:36.536Z" }, + { url = "https://files.pythonhosted.org/packages/f6/58/ac864a75067dcbd3b95be5ab4eb2b601d7fbc3d3d736a27e391a4f92a5c1/ruff-0.15.1-py3-none-win32.whl", hash = "sha256:660975d9cb49b5d5278b12b03bb9951d554543a90b74ed5d366b20e2c57c2098", size = 10462555, upload-time = "2026-02-12T23:09:29.899Z" }, + { url = "https://files.pythonhosted.org/packages/e0/5e/d4ccc8a27ecdb78116feac4935dfc39d1304536f4296168f91ed3ec00cd2/ruff-0.15.1-py3-none-win_amd64.whl", hash = "sha256:c820fef9dd5d4172a6570e5721704a96c6679b80cf7be41659ed439653f62336", size = 11599956, upload-time = "2026-02-12T23:09:01.157Z" }, + { url = "https://files.pythonhosted.org/packages/2a/07/5bda6a85b220c64c65686bc85bd0bbb23b29c62b3a9f9433fa55f17cda93/ruff-0.15.1-py3-none-win_arm64.whl", hash = "sha256:5ff7d5f0f88567850f45081fac8f4ec212be8d0b963e385c3f7d0d2eb4899416", size = 10874604, upload-time = "2026-02-12T23:09:05.515Z" }, +] + +[[package]] +name = "scikit-learn" +version = "1.8.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "joblib" }, + { name = "numpy" }, + { name = "scipy" }, + { name = "threadpoolctl" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/0e/d4/40988bf3b8e34feec1d0e6a051446b1f66225f8529b9309becaeef62b6c4/scikit_learn-1.8.0.tar.gz", hash = "sha256:9bccbb3b40e3de10351f8f5068e105d0f4083b1a65fa07b6634fbc401a6287fd", size = 7335585, upload-time = "2025-12-10T07:08:53.618Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c9/92/53ea2181da8ac6bf27170191028aee7251f8f841f8d3edbfdcaf2008fde9/scikit_learn-1.8.0-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:146b4d36f800c013d267b29168813f7a03a43ecd2895d04861f1240b564421da", size = 8595835, upload-time = "2025-12-10T07:07:39.385Z" }, + { url = "https://files.pythonhosted.org/packages/01/18/d154dc1638803adf987910cdd07097d9c526663a55666a97c124d09fb96a/scikit_learn-1.8.0-cp311-cp311-macosx_12_0_arm64.whl", hash = "sha256:f984ca4b14914e6b4094c5d52a32ea16b49832c03bd17a110f004db3c223e8e1", size = 8080381, upload-time = "2025-12-10T07:07:41.93Z" }, + { url = "https://files.pythonhosted.org/packages/8a/44/226142fcb7b7101e64fdee5f49dbe6288d4c7af8abf593237b70fca080a4/scikit_learn-1.8.0-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5e30adb87f0cc81c7690a84f7932dd66be5bac57cfe16b91cb9151683a4a2d3b", size = 8799632, upload-time = "2025-12-10T07:07:43.899Z" }, + { url = "https://files.pythonhosted.org/packages/36/4d/4a67f30778a45d542bbea5db2dbfa1e9e100bf9ba64aefe34215ba9f11f6/scikit_learn-1.8.0-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:ada8121bcb4dac28d930febc791a69f7cb1673c8495e5eee274190b73a4559c1", size = 9103788, upload-time = "2025-12-10T07:07:45.982Z" }, + { url = "https://files.pythonhosted.org/packages/89/3c/45c352094cfa60050bcbb967b1faf246b22e93cb459f2f907b600f2ceda5/scikit_learn-1.8.0-cp311-cp311-win_amd64.whl", hash = "sha256:c57b1b610bd1f40ba43970e11ce62821c2e6569e4d74023db19c6b26f246cb3b", size = 8081706, upload-time = "2025-12-10T07:07:48.111Z" }, + { url = "https://files.pythonhosted.org/packages/3d/46/5416595bb395757f754feb20c3d776553a386b661658fb21b7c814e89efe/scikit_learn-1.8.0-cp311-cp311-win_arm64.whl", hash = "sha256:2838551e011a64e3053ad7618dda9310175f7515f1742fa2d756f7c874c05961", size = 7688451, upload-time = "2025-12-10T07:07:49.873Z" }, + { url = "https://files.pythonhosted.org/packages/90/74/e6a7cc4b820e95cc38cf36cd74d5aa2b42e8ffc2d21fe5a9a9c45c1c7630/scikit_learn-1.8.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:5fb63362b5a7ddab88e52b6dbb47dac3fd7dafeee740dc6c8d8a446ddedade8e", size = 8548242, upload-time = "2025-12-10T07:07:51.568Z" }, + { url = "https://files.pythonhosted.org/packages/49/d8/9be608c6024d021041c7f0b3928d4749a706f4e2c3832bbede4fb4f58c95/scikit_learn-1.8.0-cp312-cp312-macosx_12_0_arm64.whl", hash = "sha256:5025ce924beccb28298246e589c691fe1b8c1c96507e6d27d12c5fadd85bfd76", size = 8079075, upload-time = "2025-12-10T07:07:53.697Z" }, + { url = "https://files.pythonhosted.org/packages/dd/47/f187b4636ff80cc63f21cd40b7b2d177134acaa10f6bb73746130ee8c2e5/scikit_learn-1.8.0-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4496bb2cf7a43ce1a2d7524a79e40bc5da45cf598dbf9545b7e8316ccba47bb4", size = 8660492, upload-time = "2025-12-10T07:07:55.574Z" }, + { url = "https://files.pythonhosted.org/packages/97/74/b7a304feb2b49df9fafa9382d4d09061a96ee9a9449a7cbea7988dda0828/scikit_learn-1.8.0-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:a0bcfe4d0d14aec44921545fd2af2338c7471de9cb701f1da4c9d85906ab847a", size = 8931904, upload-time = "2025-12-10T07:07:57.666Z" }, + { url = "https://files.pythonhosted.org/packages/9f/c4/0ab22726a04ede56f689476b760f98f8f46607caecff993017ac1b64aa5d/scikit_learn-1.8.0-cp312-cp312-win_amd64.whl", hash = "sha256:35c007dedb2ffe38fe3ee7d201ebac4a2deccd2408e8621d53067733e3c74809", size = 8019359, upload-time = "2025-12-10T07:07:59.838Z" }, + { url = "https://files.pythonhosted.org/packages/24/90/344a67811cfd561d7335c1b96ca21455e7e472d281c3c279c4d3f2300236/scikit_learn-1.8.0-cp312-cp312-win_arm64.whl", hash = "sha256:8c497fff237d7b4e07e9ef1a640887fa4fb765647f86fbe00f969ff6280ce2bb", size = 7641898, upload-time = "2025-12-10T07:08:01.36Z" }, + { url = "https://files.pythonhosted.org/packages/03/aa/e22e0768512ce9255eba34775be2e85c2048da73da1193e841707f8f039c/scikit_learn-1.8.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:0d6ae97234d5d7079dc0040990a6f7aeb97cb7fa7e8945f1999a429b23569e0a", size = 8513770, upload-time = "2025-12-10T07:08:03.251Z" }, + { url = "https://files.pythonhosted.org/packages/58/37/31b83b2594105f61a381fc74ca19e8780ee923be2d496fcd8d2e1147bd99/scikit_learn-1.8.0-cp313-cp313-macosx_12_0_arm64.whl", hash = "sha256:edec98c5e7c128328124a029bceb09eda2d526997780fef8d65e9a69eead963e", size = 8044458, upload-time = "2025-12-10T07:08:05.336Z" }, + { url = "https://files.pythonhosted.org/packages/2d/5a/3f1caed8765f33eabb723596666da4ebbf43d11e96550fb18bdec42b467b/scikit_learn-1.8.0-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:74b66d8689d52ed04c271e1329f0c61635bcaf5b926db9b12d58914cdc01fe57", size = 8610341, upload-time = "2025-12-10T07:08:07.732Z" }, + { url = "https://files.pythonhosted.org/packages/38/cf/06896db3f71c75902a8e9943b444a56e727418f6b4b4a90c98c934f51ed4/scikit_learn-1.8.0-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8fdf95767f989b0cfedb85f7ed8ca215d4be728031f56ff5a519ee1e3276dc2e", size = 8900022, upload-time = "2025-12-10T07:08:09.862Z" }, + { url = "https://files.pythonhosted.org/packages/1c/f9/9b7563caf3ec8873e17a31401858efab6b39a882daf6c1bfa88879c0aa11/scikit_learn-1.8.0-cp313-cp313-win_amd64.whl", hash = "sha256:2de443b9373b3b615aec1bb57f9baa6bb3a9bd093f1269ba95c17d870422b271", size = 7989409, upload-time = "2025-12-10T07:08:12.028Z" }, + { url = "https://files.pythonhosted.org/packages/49/bd/1f4001503650e72c4f6009ac0c4413cb17d2d601cef6f71c0453da2732fc/scikit_learn-1.8.0-cp313-cp313-win_arm64.whl", hash = "sha256:eddde82a035681427cbedded4e6eff5e57fa59216c2e3e90b10b19ab1d0a65c3", size = 7619760, upload-time = "2025-12-10T07:08:13.688Z" }, + { url = "https://files.pythonhosted.org/packages/d2/7d/a630359fc9dcc95496588c8d8e3245cc8fd81980251079bc09c70d41d951/scikit_learn-1.8.0-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:7cc267b6108f0a1499a734167282c00c4ebf61328566b55ef262d48e9849c735", size = 8826045, upload-time = "2025-12-10T07:08:15.215Z" }, + { url = "https://files.pythonhosted.org/packages/cc/56/a0c86f6930cfcd1c7054a2bc417e26960bb88d32444fe7f71d5c2cfae891/scikit_learn-1.8.0-cp313-cp313t-macosx_12_0_arm64.whl", hash = "sha256:fe1c011a640a9f0791146011dfd3c7d9669785f9fed2b2a5f9e207536cf5c2fd", size = 8420324, upload-time = "2025-12-10T07:08:17.561Z" }, + { url = "https://files.pythonhosted.org/packages/46/1e/05962ea1cebc1cf3876667ecb14c283ef755bf409993c5946ade3b77e303/scikit_learn-1.8.0-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:72358cce49465d140cc4e7792015bb1f0296a9742d5622c67e31399b75468b9e", size = 8680651, upload-time = "2025-12-10T07:08:19.952Z" }, + { url = "https://files.pythonhosted.org/packages/fe/56/a85473cd75f200c9759e3a5f0bcab2d116c92a8a02ee08ccd73b870f8bb4/scikit_learn-1.8.0-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:80832434a6cc114f5219211eec13dcbc16c2bac0e31ef64c6d346cde3cf054cb", size = 8925045, upload-time = "2025-12-10T07:08:22.11Z" }, + { url = "https://files.pythonhosted.org/packages/cc/b7/64d8cfa896c64435ae57f4917a548d7ac7a44762ff9802f75a79b77cb633/scikit_learn-1.8.0-cp313-cp313t-win_amd64.whl", hash = "sha256:ee787491dbfe082d9c3013f01f5991658b0f38aa8177e4cd4bf434c58f551702", size = 8507994, upload-time = "2025-12-10T07:08:23.943Z" }, + { url = "https://files.pythonhosted.org/packages/5e/37/e192ea709551799379958b4c4771ec507347027bb7c942662c7fbeba31cb/scikit_learn-1.8.0-cp313-cp313t-win_arm64.whl", hash = "sha256:bf97c10a3f5a7543f9b88cbf488d33d175e9146115a451ae34568597ba33dcde", size = 7869518, upload-time = "2025-12-10T07:08:25.71Z" }, + { url = "https://files.pythonhosted.org/packages/24/05/1af2c186174cc92dcab2233f327336058c077d38f6fe2aceb08e6ab4d509/scikit_learn-1.8.0-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:c22a2da7a198c28dd1a6e1136f19c830beab7fdca5b3e5c8bba8394f8a5c45b3", size = 8528667, upload-time = "2025-12-10T07:08:27.541Z" }, + { url = "https://files.pythonhosted.org/packages/a8/25/01c0af38fe969473fb292bba9dc2b8f9b451f3112ff242c647fee3d0dfe7/scikit_learn-1.8.0-cp314-cp314-macosx_12_0_arm64.whl", hash = "sha256:6b595b07a03069a2b1740dc08c2299993850ea81cce4fe19b2421e0c970de6b7", size = 8066524, upload-time = "2025-12-10T07:08:29.822Z" }, + { url = "https://files.pythonhosted.org/packages/be/ce/a0623350aa0b68647333940ee46fe45086c6060ec604874e38e9ab7d8e6c/scikit_learn-1.8.0-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:29ffc74089f3d5e87dfca4c2c8450f88bdc61b0fc6ed5d267f3988f19a1309f6", size = 8657133, upload-time = "2025-12-10T07:08:31.865Z" }, + { url = "https://files.pythonhosted.org/packages/b8/cb/861b41341d6f1245e6ca80b1c1a8c4dfce43255b03df034429089ca2a2c5/scikit_learn-1.8.0-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:fb65db5d7531bccf3a4f6bec3462223bea71384e2cda41da0f10b7c292b9e7c4", size = 8923223, upload-time = "2025-12-10T07:08:34.166Z" }, + { url = "https://files.pythonhosted.org/packages/76/18/a8def8f91b18cd1ba6e05dbe02540168cb24d47e8dcf69e8d00b7da42a08/scikit_learn-1.8.0-cp314-cp314-win_amd64.whl", hash = "sha256:56079a99c20d230e873ea40753102102734c5953366972a71d5cb39a32bc40c6", size = 8096518, upload-time = "2025-12-10T07:08:36.339Z" }, + { url = "https://files.pythonhosted.org/packages/d1/77/482076a678458307f0deb44e29891d6022617b2a64c840c725495bee343f/scikit_learn-1.8.0-cp314-cp314-win_arm64.whl", hash = "sha256:3bad7565bc9cf37ce19a7c0d107742b320c1285df7aab1a6e2d28780df167242", size = 7754546, upload-time = "2025-12-10T07:08:38.128Z" }, + { url = "https://files.pythonhosted.org/packages/2d/d1/ef294ca754826daa043b2a104e59960abfab4cf653891037d19dd5b6f3cf/scikit_learn-1.8.0-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:4511be56637e46c25721e83d1a9cea9614e7badc7040c4d573d75fbe257d6fd7", size = 8848305, upload-time = "2025-12-10T07:08:41.013Z" }, + { url = "https://files.pythonhosted.org/packages/5b/e2/b1f8b05138ee813b8e1a4149f2f0d289547e60851fd1bb268886915adbda/scikit_learn-1.8.0-cp314-cp314t-macosx_12_0_arm64.whl", hash = "sha256:a69525355a641bf8ef136a7fa447672fb54fe8d60cab5538d9eb7c6438543fb9", size = 8432257, upload-time = "2025-12-10T07:08:42.873Z" }, + { url = "https://files.pythonhosted.org/packages/26/11/c32b2138a85dcb0c99f6afd13a70a951bfdff8a6ab42d8160522542fb647/scikit_learn-1.8.0-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:c2656924ec73e5939c76ac4c8b026fc203b83d8900362eb2599d8aee80e4880f", size = 8678673, upload-time = "2025-12-10T07:08:45.362Z" }, + { url = "https://files.pythonhosted.org/packages/c7/57/51f2384575bdec454f4fe4e7a919d696c9ebce914590abf3e52d47607ab8/scikit_learn-1.8.0-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:15fc3b5d19cc2be65404786857f2e13c70c83dd4782676dd6814e3b89dc8f5b9", size = 8922467, upload-time = "2025-12-10T07:08:47.408Z" }, + { url = "https://files.pythonhosted.org/packages/35/4d/748c9e2872637a57981a04adc038dacaa16ba8ca887b23e34953f0b3f742/scikit_learn-1.8.0-cp314-cp314t-win_amd64.whl", hash = "sha256:00d6f1d66fbcf4eba6e356e1420d33cc06c70a45bb1363cd6f6a8e4ebbbdece2", size = 8774395, upload-time = "2025-12-10T07:08:49.337Z" }, + { url = "https://files.pythonhosted.org/packages/60/22/d7b2ebe4704a5e50790ba089d5c2ae308ab6bb852719e6c3bd4f04c3a363/scikit_learn-1.8.0-cp314-cp314t-win_arm64.whl", hash = "sha256:f28dd15c6bb0b66ba09728cf09fd8736c304be29409bd8445a080c1280619e8c", size = 8002647, upload-time = "2025-12-10T07:08:51.601Z" }, +] + +[[package]] +name = "scipy" +version = "1.17.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/56/3e/9cca699f3486ce6bc12ff46dc2031f1ec8eb9ccc9a320fdaf925f1417426/scipy-1.17.0.tar.gz", hash = "sha256:2591060c8e648d8b96439e111ac41fd8342fdeff1876be2e19dea3fe8930454e", size = 30396830, upload-time = "2026-01-10T21:34:23.009Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1e/4b/c89c131aa87cad2b77a54eb0fb94d633a842420fa7e919dc2f922037c3d8/scipy-1.17.0-cp311-cp311-macosx_10_14_x86_64.whl", hash = "sha256:2abd71643797bd8a106dff97894ff7869eeeb0af0f7a5ce02e4227c6a2e9d6fd", size = 31381316, upload-time = "2026-01-10T21:24:33.42Z" }, + { url = "https://files.pythonhosted.org/packages/5e/5f/a6b38f79a07d74989224d5f11b55267714707582908a5f1ae854cf9a9b84/scipy-1.17.0-cp311-cp311-macosx_12_0_arm64.whl", hash = "sha256:ef28d815f4d2686503e5f4f00edc387ae58dfd7a2f42e348bb53359538f01558", size = 27966760, upload-time = "2026-01-10T21:24:38.911Z" }, + { url = "https://files.pythonhosted.org/packages/c1/20/095ad24e031ee8ed3c5975954d816b8e7e2abd731e04f8be573de8740885/scipy-1.17.0-cp311-cp311-macosx_14_0_arm64.whl", hash = "sha256:272a9f16d6bb4667e8b50d25d71eddcc2158a214df1b566319298de0939d2ab7", size = 20138701, upload-time = "2026-01-10T21:24:43.249Z" }, + { url = "https://files.pythonhosted.org/packages/89/11/4aad2b3858d0337756f3323f8960755704e530b27eb2a94386c970c32cbe/scipy-1.17.0-cp311-cp311-macosx_14_0_x86_64.whl", hash = "sha256:7204fddcbec2fe6598f1c5fdf027e9f259106d05202a959a9f1aecf036adc9f6", size = 22480574, upload-time = "2026-01-10T21:24:47.266Z" }, + { url = "https://files.pythonhosted.org/packages/85/bd/f5af70c28c6da2227e510875cadf64879855193a687fb19951f0f44cfd6b/scipy-1.17.0-cp311-cp311-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:fc02c37a5639ee67d8fb646ffded6d793c06c5622d36b35cfa8fe5ececb8f042", size = 32862414, upload-time = "2026-01-10T21:24:52.566Z" }, + { url = "https://files.pythonhosted.org/packages/ef/df/df1457c4df3826e908879fe3d76bc5b6e60aae45f4ee42539512438cfd5d/scipy-1.17.0-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:dac97a27520d66c12a34fd90a4fe65f43766c18c0d6e1c0a80f114d2260080e4", size = 35112380, upload-time = "2026-01-10T21:24:58.433Z" }, + { url = "https://files.pythonhosted.org/packages/5f/bb/88e2c16bd1dd4de19d80d7c5e238387182993c2fb13b4b8111e3927ad422/scipy-1.17.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:ebb7446a39b3ae0fe8f416a9a3fdc6fba3f11c634f680f16a239c5187bc487c0", size = 34922676, upload-time = "2026-01-10T21:25:04.287Z" }, + { url = "https://files.pythonhosted.org/packages/02/ba/5120242cc735f71fc002cff0303d536af4405eb265f7c60742851e7ccfe9/scipy-1.17.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:474da16199f6af66601a01546144922ce402cb17362e07d82f5a6cf8f963e449", size = 37507599, upload-time = "2026-01-10T21:25:09.851Z" }, + { url = "https://files.pythonhosted.org/packages/52/c8/08629657ac6c0da198487ce8cd3de78e02cfde42b7f34117d56a3fe249dc/scipy-1.17.0-cp311-cp311-win_amd64.whl", hash = "sha256:255c0da161bd7b32a6c898e7891509e8a9289f0b1c6c7d96142ee0d2b114c2ea", size = 36380284, upload-time = "2026-01-10T21:25:15.632Z" }, + { url = "https://files.pythonhosted.org/packages/6c/4a/465f96d42c6f33ad324a40049dfd63269891db9324aa66c4a1c108c6f994/scipy-1.17.0-cp311-cp311-win_arm64.whl", hash = "sha256:85b0ac3ad17fa3be50abd7e69d583d98792d7edc08367e01445a1e2076005379", size = 24370427, upload-time = "2026-01-10T21:25:20.514Z" }, + { url = "https://files.pythonhosted.org/packages/0b/11/7241a63e73ba5a516f1930ac8d5b44cbbfabd35ac73a2d08ca206df007c4/scipy-1.17.0-cp312-cp312-macosx_10_14_x86_64.whl", hash = "sha256:0d5018a57c24cb1dd828bcf51d7b10e65986d549f52ef5adb6b4d1ded3e32a57", size = 31364580, upload-time = "2026-01-10T21:25:25.717Z" }, + { url = "https://files.pythonhosted.org/packages/ed/1d/5057f812d4f6adc91a20a2d6f2ebcdb517fdbc87ae3acc5633c9b97c8ba5/scipy-1.17.0-cp312-cp312-macosx_12_0_arm64.whl", hash = "sha256:88c22af9e5d5a4f9e027e26772cc7b5922fab8bcc839edb3ae33de404feebd9e", size = 27969012, upload-time = "2026-01-10T21:25:30.921Z" }, + { url = "https://files.pythonhosted.org/packages/e3/21/f6ec556c1e3b6ec4e088da667d9987bb77cc3ab3026511f427dc8451187d/scipy-1.17.0-cp312-cp312-macosx_14_0_arm64.whl", hash = "sha256:f3cd947f20fe17013d401b64e857c6b2da83cae567adbb75b9dcba865abc66d8", size = 20140691, upload-time = "2026-01-10T21:25:34.802Z" }, + { url = "https://files.pythonhosted.org/packages/7a/fe/5e5ad04784964ba964a96f16c8d4676aa1b51357199014dce58ab7ec5670/scipy-1.17.0-cp312-cp312-macosx_14_0_x86_64.whl", hash = "sha256:e8c0b331c2c1f531eb51f1b4fc9ba709521a712cce58f1aa627bc007421a5306", size = 22463015, upload-time = "2026-01-10T21:25:39.277Z" }, + { url = "https://files.pythonhosted.org/packages/4a/69/7c347e857224fcaf32a34a05183b9d8a7aca25f8f2d10b8a698b8388561a/scipy-1.17.0-cp312-cp312-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5194c445d0a1c7a6c1a4a4681b6b7c71baad98ff66d96b949097e7513c9d6742", size = 32724197, upload-time = "2026-01-10T21:25:44.084Z" }, + { url = "https://files.pythonhosted.org/packages/d1/fe/66d73b76d378ba8cc2fe605920c0c75092e3a65ae746e1e767d9d020a75a/scipy-1.17.0-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9eeb9b5f5997f75507814ed9d298ab23f62cf79f5a3ef90031b1ee2506abdb5b", size = 35009148, upload-time = "2026-01-10T21:25:50.591Z" }, + { url = "https://files.pythonhosted.org/packages/af/07/07dec27d9dc41c18d8c43c69e9e413431d20c53a0339c388bcf72f353c4b/scipy-1.17.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:40052543f7bbe921df4408f46003d6f01c6af109b9e2c8a66dd1cf6cf57f7d5d", size = 34798766, upload-time = "2026-01-10T21:25:59.41Z" }, + { url = "https://files.pythonhosted.org/packages/81/61/0470810c8a093cdacd4ba7504b8a218fd49ca070d79eca23a615f5d9a0b0/scipy-1.17.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:0cf46c8013fec9d3694dc572f0b54100c28405d55d3e2cb15e2895b25057996e", size = 37405953, upload-time = "2026-01-10T21:26:07.75Z" }, + { url = "https://files.pythonhosted.org/packages/92/ce/672ed546f96d5d41ae78c4b9b02006cedd0b3d6f2bf5bb76ea455c320c28/scipy-1.17.0-cp312-cp312-win_amd64.whl", hash = "sha256:0937a0b0d8d593a198cededd4c439a0ea216a3f36653901ea1f3e4be949056f8", size = 36328121, upload-time = "2026-01-10T21:26:16.509Z" }, + { url = "https://files.pythonhosted.org/packages/9d/21/38165845392cae67b61843a52c6455d47d0cc2a40dd495c89f4362944654/scipy-1.17.0-cp312-cp312-win_arm64.whl", hash = "sha256:f603d8a5518c7426414d1d8f82e253e454471de682ce5e39c29adb0df1efb86b", size = 24314368, upload-time = "2026-01-10T21:26:23.087Z" }, + { url = "https://files.pythonhosted.org/packages/0c/51/3468fdfd49387ddefee1636f5cf6d03ce603b75205bf439bbf0e62069bfd/scipy-1.17.0-cp313-cp313-macosx_10_14_x86_64.whl", hash = "sha256:65ec32f3d32dfc48c72df4291345dae4f048749bc8d5203ee0a3f347f96c5ce6", size = 31344101, upload-time = "2026-01-10T21:26:30.25Z" }, + { url = "https://files.pythonhosted.org/packages/b2/9a/9406aec58268d437636069419e6977af953d1e246df941d42d3720b7277b/scipy-1.17.0-cp313-cp313-macosx_12_0_arm64.whl", hash = "sha256:1f9586a58039d7229ce77b52f8472c972448cded5736eaf102d5658bbac4c269", size = 27950385, upload-time = "2026-01-10T21:26:36.801Z" }, + { url = "https://files.pythonhosted.org/packages/4f/98/e7342709e17afdfd1b26b56ae499ef4939b45a23a00e471dfb5375eea205/scipy-1.17.0-cp313-cp313-macosx_14_0_arm64.whl", hash = "sha256:9fad7d3578c877d606b1150135c2639e9de9cecd3705caa37b66862977cc3e72", size = 20122115, upload-time = "2026-01-10T21:26:42.107Z" }, + { url = "https://files.pythonhosted.org/packages/fd/0e/9eeeb5357a64fd157cbe0302c213517c541cc16b8486d82de251f3c68ede/scipy-1.17.0-cp313-cp313-macosx_14_0_x86_64.whl", hash = "sha256:423ca1f6584fc03936972b5f7c06961670dbba9f234e71676a7c7ccf938a0d61", size = 22442402, upload-time = "2026-01-10T21:26:48.029Z" }, + { url = "https://files.pythonhosted.org/packages/c9/10/be13397a0e434f98e0c79552b2b584ae5bb1c8b2be95db421533bbca5369/scipy-1.17.0-cp313-cp313-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:fe508b5690e9eaaa9467fc047f833af58f1152ae51a0d0aed67aa5801f4dd7d6", size = 32696338, upload-time = "2026-01-10T21:26:55.521Z" }, + { url = "https://files.pythonhosted.org/packages/63/1e/12fbf2a3bb240161651c94bb5cdd0eae5d4e8cc6eaeceb74ab07b12a753d/scipy-1.17.0-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6680f2dfd4f6182e7d6db161344537da644d1cf85cf293f015c60a17ecf08752", size = 34977201, upload-time = "2026-01-10T21:27:03.501Z" }, + { url = "https://files.pythonhosted.org/packages/19/5b/1a63923e23ccd20bd32156d7dd708af5bbde410daa993aa2500c847ab2d2/scipy-1.17.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:eec3842ec9ac9de5917899b277428886042a93db0b227ebbe3a333b64ec7643d", size = 34777384, upload-time = "2026-01-10T21:27:11.423Z" }, + { url = "https://files.pythonhosted.org/packages/39/22/b5da95d74edcf81e540e467202a988c50fef41bd2011f46e05f72ba07df6/scipy-1.17.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:d7425fcafbc09a03731e1bc05581f5fad988e48c6a861f441b7ab729a49a55ea", size = 37379586, upload-time = "2026-01-10T21:27:20.171Z" }, + { url = "https://files.pythonhosted.org/packages/b9/b6/8ac583d6da79e7b9e520579f03007cb006f063642afd6b2eeb16b890bf93/scipy-1.17.0-cp313-cp313-win_amd64.whl", hash = "sha256:87b411e42b425b84777718cc41516b8a7e0795abfa8e8e1d573bf0ef014f0812", size = 36287211, upload-time = "2026-01-10T21:28:43.122Z" }, + { url = "https://files.pythonhosted.org/packages/55/fb/7db19e0b3e52f882b420417644ec81dd57eeef1bd1705b6f689d8ff93541/scipy-1.17.0-cp313-cp313-win_arm64.whl", hash = "sha256:357ca001c6e37601066092e7c89cca2f1ce74e2a520ca78d063a6d2201101df2", size = 24312646, upload-time = "2026-01-10T21:28:49.893Z" }, + { url = "https://files.pythonhosted.org/packages/20/b6/7feaa252c21cc7aff335c6c55e1b90ab3e3306da3f048109b8b639b94648/scipy-1.17.0-cp313-cp313t-macosx_10_14_x86_64.whl", hash = "sha256:ec0827aa4d36cb79ff1b81de898e948a51ac0b9b1c43e4a372c0508c38c0f9a3", size = 31693194, upload-time = "2026-01-10T21:27:27.454Z" }, + { url = "https://files.pythonhosted.org/packages/76/bb/bbb392005abce039fb7e672cb78ac7d158700e826b0515cab6b5b60c26fb/scipy-1.17.0-cp313-cp313t-macosx_12_0_arm64.whl", hash = "sha256:819fc26862b4b3c73a60d486dbb919202f3d6d98c87cf20c223511429f2d1a97", size = 28365415, upload-time = "2026-01-10T21:27:34.26Z" }, + { url = "https://files.pythonhosted.org/packages/37/da/9d33196ecc99fba16a409c691ed464a3a283ac454a34a13a3a57c0d66f3a/scipy-1.17.0-cp313-cp313t-macosx_14_0_arm64.whl", hash = "sha256:363ad4ae2853d88ebcde3ae6ec46ccca903ea9835ee8ba543f12f575e7b07e4e", size = 20537232, upload-time = "2026-01-10T21:27:40.306Z" }, + { url = "https://files.pythonhosted.org/packages/56/9d/f4b184f6ddb28e9a5caea36a6f98e8ecd2a524f9127354087ce780885d83/scipy-1.17.0-cp313-cp313t-macosx_14_0_x86_64.whl", hash = "sha256:979c3a0ff8e5ba254d45d59ebd38cde48fce4f10b5125c680c7a4bfe177aab07", size = 22791051, upload-time = "2026-01-10T21:27:46.539Z" }, + { url = "https://files.pythonhosted.org/packages/9b/9d/025cccdd738a72140efc582b1641d0dd4caf2e86c3fb127568dc80444e6e/scipy-1.17.0-cp313-cp313t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:130d12926ae34399d157de777472bf82e9061c60cc081372b3118edacafe1d00", size = 32815098, upload-time = "2026-01-10T21:27:54.389Z" }, + { url = "https://files.pythonhosted.org/packages/48/5f/09b879619f8bca15ce392bfc1894bd9c54377e01d1b3f2f3b595a1b4d945/scipy-1.17.0-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:6e886000eb4919eae3a44f035e63f0fd8b651234117e8f6f29bad1cd26e7bc45", size = 35031342, upload-time = "2026-01-10T21:28:03.012Z" }, + { url = "https://files.pythonhosted.org/packages/f2/9a/f0f0a9f0aa079d2f106555b984ff0fbb11a837df280f04f71f056ea9c6e4/scipy-1.17.0-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:13c4096ac6bc31d706018f06a49abe0485f96499deb82066b94d19b02f664209", size = 34893199, upload-time = "2026-01-10T21:28:10.832Z" }, + { url = "https://files.pythonhosted.org/packages/90/b8/4f0f5cf0c5ea4d7548424e6533e6b17d164f34a6e2fb2e43ffebb6697b06/scipy-1.17.0-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:cacbaddd91fcffde703934897c5cd2c7cb0371fac195d383f4e1f1c5d3f3bd04", size = 37438061, upload-time = "2026-01-10T21:28:19.684Z" }, + { url = "https://files.pythonhosted.org/packages/f9/cc/2bd59140ed3b2fa2882fb15da0a9cb1b5a6443d67cfd0d98d4cec83a57ec/scipy-1.17.0-cp313-cp313t-win_amd64.whl", hash = "sha256:edce1a1cf66298cccdc48a1bdf8fb10a3bf58e8b58d6c3883dd1530e103f87c0", size = 36328593, upload-time = "2026-01-10T21:28:28.007Z" }, + { url = "https://files.pythonhosted.org/packages/13/1b/c87cc44a0d2c7aaf0f003aef2904c3d097b422a96c7e7c07f5efd9073c1b/scipy-1.17.0-cp313-cp313t-win_arm64.whl", hash = "sha256:30509da9dbec1c2ed8f168b8d8aa853bc6723fede1dbc23c7d43a56f5ab72a67", size = 24625083, upload-time = "2026-01-10T21:28:35.188Z" }, + { url = "https://files.pythonhosted.org/packages/1a/2d/51006cd369b8e7879e1c630999a19d1fbf6f8b5ed3e33374f29dc87e53b3/scipy-1.17.0-cp314-cp314-macosx_10_14_x86_64.whl", hash = "sha256:c17514d11b78be8f7e6331b983a65a7f5ca1fd037b95e27b280921fe5606286a", size = 31346803, upload-time = "2026-01-10T21:28:57.24Z" }, + { url = "https://files.pythonhosted.org/packages/d6/2e/2349458c3ce445f53a6c93d4386b1c4c5c0c540917304c01222ff95ff317/scipy-1.17.0-cp314-cp314-macosx_12_0_arm64.whl", hash = "sha256:4e00562e519c09da34c31685f6acc3aa384d4d50604db0f245c14e1b4488bfa2", size = 27967182, upload-time = "2026-01-10T21:29:04.107Z" }, + { url = "https://files.pythonhosted.org/packages/5e/7c/df525fbfa77b878d1cfe625249529514dc02f4fd5f45f0f6295676a76528/scipy-1.17.0-cp314-cp314-macosx_14_0_arm64.whl", hash = "sha256:f7df7941d71314e60a481e02d5ebcb3f0185b8d799c70d03d8258f6c80f3d467", size = 20139125, upload-time = "2026-01-10T21:29:10.179Z" }, + { url = "https://files.pythonhosted.org/packages/33/11/fcf9d43a7ed1234d31765ec643b0515a85a30b58eddccc5d5a4d12b5f194/scipy-1.17.0-cp314-cp314-macosx_14_0_x86_64.whl", hash = "sha256:aabf057c632798832f071a8dde013c2e26284043934f53b00489f1773b33527e", size = 22443554, upload-time = "2026-01-10T21:29:15.888Z" }, + { url = "https://files.pythonhosted.org/packages/80/5c/ea5d239cda2dd3d31399424967a24d556cf409fbea7b5b21412b0fd0a44f/scipy-1.17.0-cp314-cp314-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a38c3337e00be6fd8a95b4ed66b5d988bac4ec888fd922c2ea9fe5fb1603dd67", size = 32757834, upload-time = "2026-01-10T21:29:23.406Z" }, + { url = "https://files.pythonhosted.org/packages/b8/7e/8c917cc573310e5dc91cbeead76f1b600d3fb17cf0969db02c9cf92e3cfa/scipy-1.17.0-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:00fb5f8ec8398ad90215008d8b6009c9db9fa924fd4c7d6be307c6f945f9cd73", size = 34995775, upload-time = "2026-01-10T21:29:31.915Z" }, + { url = "https://files.pythonhosted.org/packages/c5/43/176c0c3c07b3f7df324e7cdd933d3e2c4898ca202b090bd5ba122f9fe270/scipy-1.17.0-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:f2a4942b0f5f7c23c7cd641a0ca1955e2ae83dedcff537e3a0259096635e186b", size = 34841240, upload-time = "2026-01-10T21:29:39.995Z" }, + { url = "https://files.pythonhosted.org/packages/44/8c/d1f5f4b491160592e7f084d997de53a8e896a3ac01cd07e59f43ca222744/scipy-1.17.0-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:dbf133ced83889583156566d2bdf7a07ff89228fe0c0cb727f777de92092ec6b", size = 37394463, upload-time = "2026-01-10T21:29:48.723Z" }, + { url = "https://files.pythonhosted.org/packages/9f/ec/42a6657f8d2d087e750e9a5dde0b481fd135657f09eaf1cf5688bb23c338/scipy-1.17.0-cp314-cp314-win_amd64.whl", hash = "sha256:3625c631a7acd7cfd929e4e31d2582cf00f42fcf06011f59281271746d77e061", size = 37053015, upload-time = "2026-01-10T21:30:51.418Z" }, + { url = "https://files.pythonhosted.org/packages/27/58/6b89a6afd132787d89a362d443a7bddd511b8f41336a1ae47f9e4f000dc4/scipy-1.17.0-cp314-cp314-win_arm64.whl", hash = "sha256:9244608d27eafe02b20558523ba57f15c689357c85bdcfe920b1828750aa26eb", size = 24951312, upload-time = "2026-01-10T21:30:56.771Z" }, + { url = "https://files.pythonhosted.org/packages/e9/01/f58916b9d9ae0112b86d7c3b10b9e685625ce6e8248df139d0fcb17f7397/scipy-1.17.0-cp314-cp314t-macosx_10_14_x86_64.whl", hash = "sha256:2b531f57e09c946f56ad0b4a3b2abee778789097871fc541e267d2eca081cff1", size = 31706502, upload-time = "2026-01-10T21:29:56.326Z" }, + { url = "https://files.pythonhosted.org/packages/59/8e/2912a87f94a7d1f8b38aabc0faf74b82d3b6c9e22be991c49979f0eceed8/scipy-1.17.0-cp314-cp314t-macosx_12_0_arm64.whl", hash = "sha256:13e861634a2c480bd237deb69333ac79ea1941b94568d4b0efa5db5e263d4fd1", size = 28380854, upload-time = "2026-01-10T21:30:01.554Z" }, + { url = "https://files.pythonhosted.org/packages/bd/1c/874137a52dddab7d5d595c1887089a2125d27d0601fce8c0026a24a92a0b/scipy-1.17.0-cp314-cp314t-macosx_14_0_arm64.whl", hash = "sha256:eb2651271135154aa24f6481cbae5cc8af1f0dd46e6533fb7b56aa9727b6a232", size = 20552752, upload-time = "2026-01-10T21:30:05.93Z" }, + { url = "https://files.pythonhosted.org/packages/3f/f0/7518d171cb735f6400f4576cf70f756d5b419a07fe1867da34e2c2c9c11b/scipy-1.17.0-cp314-cp314t-macosx_14_0_x86_64.whl", hash = "sha256:c5e8647f60679790c2f5c76be17e2e9247dc6b98ad0d3b065861e082c56e078d", size = 22803972, upload-time = "2026-01-10T21:30:10.651Z" }, + { url = "https://files.pythonhosted.org/packages/7c/74/3498563a2c619e8a3ebb4d75457486c249b19b5b04a30600dfd9af06bea5/scipy-1.17.0-cp314-cp314t-manylinux_2_27_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:5fb10d17e649e1446410895639f3385fd2bf4c3c7dfc9bea937bddcbc3d7b9ba", size = 32829770, upload-time = "2026-01-10T21:30:16.359Z" }, + { url = "https://files.pythonhosted.org/packages/48/d1/7b50cedd8c6c9d6f706b4b36fa8544d829c712a75e370f763b318e9638c1/scipy-1.17.0-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8547e7c57f932e7354a2319fab613981cde910631979f74c9b542bb167a8b9db", size = 35051093, upload-time = "2026-01-10T21:30:22.987Z" }, + { url = "https://files.pythonhosted.org/packages/e2/82/a2d684dfddb87ba1b3ea325df7c3293496ee9accb3a19abe9429bce94755/scipy-1.17.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:33af70d040e8af9d5e7a38b5ed3b772adddd281e3062ff23fec49e49681c38cf", size = 34909905, upload-time = "2026-01-10T21:30:28.704Z" }, + { url = "https://files.pythonhosted.org/packages/ef/5e/e565bd73991d42023eb82bb99e51c5b3d9e2c588ca9d4b3e2cc1d3ca62a6/scipy-1.17.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:f9eb55bb97d00f8b7ab95cb64f873eb0bf54d9446264d9f3609130381233483f", size = 37457743, upload-time = "2026-01-10T21:30:34.819Z" }, + { url = "https://files.pythonhosted.org/packages/58/a8/a66a75c3d8f1fb2b83f66007d6455a06a6f6cf5618c3dc35bc9b69dd096e/scipy-1.17.0-cp314-cp314t-win_amd64.whl", hash = "sha256:1ff269abf702f6c7e67a4b7aad981d42871a11b9dd83c58d2d2ea624efbd1088", size = 37098574, upload-time = "2026-01-10T21:30:40.782Z" }, + { url = "https://files.pythonhosted.org/packages/56/a5/df8f46ef7da168f1bc52cd86e09a9de5c6f19cc1da04454d51b7d4f43408/scipy-1.17.0-cp314-cp314t-win_arm64.whl", hash = "sha256:031121914e295d9791319a1875444d55079885bbae5bdc9c5e0f2ee5f09d34ff", size = 25246266, upload-time = "2026-01-10T21:30:45.923Z" }, +] + +[[package]] +name = "seaborn" +version = "0.13.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "matplotlib" }, + { name = "numpy" }, + { name = "pandas" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/86/59/a451d7420a77ab0b98f7affa3a1d78a313d2f7281a57afb1a34bae8ab412/seaborn-0.13.2.tar.gz", hash = "sha256:93e60a40988f4d65e9f4885df477e2fdaff6b73a9ded434c1ab356dd57eefff7", size = 1457696, upload-time = "2024-01-25T13:21:52.551Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/83/11/00d3c3dfc25ad54e731d91449895a79e4bf2384dc3ac01809010ba88f6d5/seaborn-0.13.2-py3-none-any.whl", hash = "sha256:636f8336facf092165e27924f223d3c62ca560b1f2bb5dff7ab7fad265361987", size = 294914, upload-time = "2024-01-25T13:21:49.598Z" }, +] + +[[package]] +name = "setuptools" +version = "82.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/82/f3/748f4d6f65d1756b9ae577f329c951cda23fb900e4de9f70900ced962085/setuptools-82.0.0.tar.gz", hash = "sha256:22e0a2d69474c6ae4feb01951cb69d515ed23728cf96d05513d36e42b62b37cb", size = 1144893, upload-time = "2026-02-08T15:08:40.206Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e1/c6/76dc613121b793286a3f91621d7b75a2b493e0390ddca50f11993eadf192/setuptools-82.0.0-py3-none-any.whl", hash = "sha256:70b18734b607bd1da571d097d236cfcfacaf01de45717d59e6e04b96877532e0", size = 1003468, upload-time = "2026-02-08T15:08:38.723Z" }, +] + +[[package]] +name = "simple-websocket" +version = "1.1.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "wsproto" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/b0/d4/bfa032f961103eba93de583b161f0e6a5b63cebb8f2c7d0c6e6efe1e3d2e/simple_websocket-1.1.0.tar.gz", hash = "sha256:7939234e7aa067c534abdab3a9ed933ec9ce4691b0713c78acb195560aa52ae4", size = 17300, upload-time = "2024-10-10T22:39:31.412Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/52/59/0782e51887ac6b07ffd1570e0364cf901ebc36345fea669969d2084baebb/simple_websocket-1.1.0-py3-none-any.whl", hash = "sha256:4af6069630a38ed6c561010f0e11a5bc0d4ca569b36306eb257cd9a192497c8c", size = 13842, upload-time = "2024-10-10T22:39:29.645Z" }, +] + +[[package]] +name = "six" +version = "1.17.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/94/e7/b2c673351809dca68a0e064b6af791aa332cf192da575fd474ed7d6f16a2/six-1.17.0.tar.gz", hash = "sha256:ff70335d468e7eb6ec65b95b99d3a2836546063f63acc5171de367e834932a81", size = 34031, upload-time = "2024-12-04T17:35:28.174Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/b7/ce/149a00dd41f10bc29e5921b496af8b574d8413afcd5e30dfa0ed46c2cc5e/six-1.17.0-py2.py3-none-any.whl", hash = "sha256:4721f391ed90541fddacab5acf947aa0d3dc7d27b2e1e8eda2be8970586c3274", size = 11050, upload-time = "2024-12-04T17:35:26.475Z" }, +] + +[[package]] +name = "snowballstemmer" +version = "3.0.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/75/a7/9810d872919697c9d01295633f5d574fb416d47e535f258272ca1f01f447/snowballstemmer-3.0.1.tar.gz", hash = "sha256:6d5eeeec8e9f84d4d56b847692bacf79bc2c8e90c7f80ca4444ff8b6f2e52895", size = 105575, upload-time = "2025-05-09T16:34:51.843Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c8/78/3565d011c61f5a43488987ee32b6f3f656e7f107ac2782dd57bdd7d91d9a/snowballstemmer-3.0.1-py3-none-any.whl", hash = "sha256:6cd7b3897da8d6c9ffb968a6781fa6532dce9c3618a4b127d920dab764a19064", size = 103274, upload-time = "2025-05-09T16:34:50.371Z" }, +] + +[[package]] +name = "sphinx" +version = "9.0.4" +source = { registry = "https://pypi.org/simple" } +resolution-markers = [ + "python_full_version < '3.12' and sys_platform == 'win32'", + "python_full_version < '3.12' and sys_platform == 'emscripten'", + "python_full_version < '3.12' and sys_platform != 'emscripten' and sys_platform != 'win32'", +] +dependencies = [ + { name = "alabaster", marker = "python_full_version < '3.12'" }, + { name = "babel", marker = "python_full_version < '3.12'" }, + { name = "colorama", marker = "python_full_version < '3.12' and sys_platform == 'win32'" }, + { name = "docutils", marker = "python_full_version < '3.12'" }, + { name = "imagesize", marker = "python_full_version < '3.12'" }, + { name = "jinja2", marker = "python_full_version < '3.12'" }, + { name = "packaging", marker = "python_full_version < '3.12'" }, + { name = "pygments", marker = "python_full_version < '3.12'" }, + { name = "requests", marker = "python_full_version < '3.12'" }, + { name = "roman-numerals", marker = "python_full_version < '3.12'" }, + { name = "snowballstemmer", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-applehelp", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-devhelp", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-htmlhelp", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-jsmath", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-qthelp", marker = "python_full_version < '3.12'" }, + { name = "sphinxcontrib-serializinghtml", marker = "python_full_version < '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/42/50/a8c6ccc36d5eacdfd7913ddccd15a9cee03ecafc5ee2bc40e1f168d85022/sphinx-9.0.4.tar.gz", hash = "sha256:594ef59d042972abbc581d8baa577404abe4e6c3b04ef61bd7fc2acbd51f3fa3", size = 8710502, upload-time = "2025-12-04T07:45:27.343Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c6/3f/4bbd76424c393caead2e1eb89777f575dee5c8653e2d4b6afd7a564f5974/sphinx-9.0.4-py3-none-any.whl", hash = "sha256:5bebc595a5e943ea248b99c13814c1c5e10b3ece718976824ffa7959ff95fffb", size = 3917713, upload-time = "2025-12-04T07:45:24.944Z" }, +] + +[[package]] +name = "sphinx" +version = "9.1.0" +source = { registry = "https://pypi.org/simple" } +resolution-markers = [ + "python_full_version >= '3.14' and sys_platform == 'win32'", + "python_full_version >= '3.14' and sys_platform == 'emscripten'", + "python_full_version >= '3.14' and sys_platform != 'emscripten' and sys_platform != 'win32'", + "python_full_version == '3.13.*' and sys_platform == 'win32'", + "python_full_version == '3.12.*' and sys_platform == 'win32'", + "python_full_version == '3.13.*' and sys_platform == 'emscripten'", + "python_full_version == '3.12.*' and sys_platform == 'emscripten'", + "python_full_version == '3.13.*' and sys_platform != 'emscripten' and sys_platform != 'win32'", + "python_full_version == '3.12.*' and sys_platform != 'emscripten' and sys_platform != 'win32'", +] +dependencies = [ + { name = "alabaster", marker = "python_full_version >= '3.12'" }, + { name = "babel", marker = "python_full_version >= '3.12'" }, + { name = "colorama", marker = "python_full_version >= '3.12' and sys_platform == 'win32'" }, + { name = "docutils", marker = "python_full_version >= '3.12'" }, + { name = "imagesize", marker = "python_full_version >= '3.12'" }, + { name = "jinja2", marker = "python_full_version >= '3.12'" }, + { name = "packaging", marker = "python_full_version >= '3.12'" }, + { name = "pygments", marker = "python_full_version >= '3.12'" }, + { name = "requests", marker = "python_full_version >= '3.12'" }, + { name = "roman-numerals", marker = "python_full_version >= '3.12'" }, + { name = "snowballstemmer", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-applehelp", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-devhelp", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-htmlhelp", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-jsmath", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-qthelp", marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-serializinghtml", marker = "python_full_version >= '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/cd/bd/f08eb0f4eed5c83f1ba2a3bd18f7745a2b1525fad70660a1c00224ec468a/sphinx-9.1.0.tar.gz", hash = "sha256:7741722357dd75f8190766926071fed3bdc211c74dd2d7d4df5404da95930ddb", size = 8718324, upload-time = "2025-12-31T15:09:27.646Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/73/f7/b1884cb3188ab181fc81fa00c266699dab600f927a964df02ec3d5d1916a/sphinx-9.1.0-py3-none-any.whl", hash = "sha256:c84fdd4e782504495fe4f2c0b3413d6c2bf388589bb352d439b2a3bb99991978", size = 3921742, upload-time = "2025-12-31T15:09:25.561Z" }, +] + +[[package]] +name = "sphinx-autobuild" +version = "2025.8.25" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "colorama" }, + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, + { name = "starlette" }, + { name = "uvicorn" }, + { name = "watchfiles" }, + { name = "websockets" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/e0/3c/a59a3a453d4133777f7ed2e83c80b7dc817d43c74b74298ca0af869662ad/sphinx_autobuild-2025.8.25.tar.gz", hash = "sha256:9cf5aab32853c8c31af572e4fecdc09c997e2b8be5a07daf2a389e270e85b213", size = 15200, upload-time = "2025-08-25T18:44:55.436Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d7/20/56411b52f917696995f5ad27d2ea7e9492c84a043c5b49a3a3173573cd93/sphinx_autobuild-2025.8.25-py3-none-any.whl", hash = "sha256:b750ac7d5a18603e4665294323fd20f6dcc0a984117026d1986704fa68f0379a", size = 12535, upload-time = "2025-08-25T18:44:54.164Z" }, +] + +[[package]] +name = "sphinx-click" +version = "6.2.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "click" }, + { name = "docutils" }, + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/9a/ed/a9767cd1b8b7fbdf260a89d5c8c86e20e3536b9878579e5ab7965a291e55/sphinx_click-6.2.0.tar.gz", hash = "sha256:fc78b4154a4e5159462e36de55b8643747da6cda86b3b52a8bb62289e603776c", size = 27035, upload-time = "2025-12-04T19:33:05.437Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/44/bd/cb244695f67f77b0a36200ce1670fc42a6fe2770847e870daab99cc2b177/sphinx_click-6.2.0-py3-none-any.whl", hash = "sha256:1fb1851cb4f2c286d43cbcd57f55db6ef5a8d208bfc3370f19adde232e5803d7", size = 8939, upload-time = "2025-12-04T19:33:04.037Z" }, +] + +[[package]] +name = "sphinx-mdinclude" +version = "0.6.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "docutils" }, + { name = "mistune" }, + { name = "pygments" }, + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/b6/a7/c9a7888bb2187fdb06955d71e75f6f266b7e179b356ac76138d160a5b7eb/sphinx_mdinclude-0.6.2.tar.gz", hash = "sha256:447462e82cb8be61404a2204227f920769eb923d2f57608e3325f3bb88286b4c", size = 65257, upload-time = "2024-08-03T19:07:37.643Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/42/3d/6b41fe1637cd53c4b10d56e0e6f396546f837973dabf9c4b2a1de44620ac/sphinx_mdinclude-0.6.2-py3-none-any.whl", hash = "sha256:648e78edb067c0e4bffc22943278d49d54a0714494743592032fa3ad82a86984", size = 16911, upload-time = "2024-08-03T19:07:30.406Z" }, +] + +[[package]] +name = "sphinx-rtd-theme" +version = "3.1.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "docutils" }, + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, + { name = "sphinxcontrib-jquery" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/84/68/a1bfbf38c0f7bccc9b10bbf76b94606f64acb1552ae394f0b8285bfaea25/sphinx_rtd_theme-3.1.0.tar.gz", hash = "sha256:b44276f2c276e909239a4f6c955aa667aaafeb78597923b1c60babc76db78e4c", size = 7620915, upload-time = "2026-01-12T16:03:31.17Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/87/c7/b5c8015d823bfda1a346adb2c634a2101d50bb75d421eb6dcb31acd25ebc/sphinx_rtd_theme-3.1.0-py2.py3-none-any.whl", hash = "sha256:1785824ae8e6632060490f67cf3a72d404a85d2d9fc26bce3619944de5682b89", size = 7655617, upload-time = "2026-01-12T16:03:28.101Z" }, +] + +[[package]] +name = "sphinxcontrib-applehelp" +version = "2.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/ba/6e/b837e84a1a704953c62ef8776d45c3e8d759876b4a84fe14eba2859106fe/sphinxcontrib_applehelp-2.0.0.tar.gz", hash = "sha256:2f29ef331735ce958efa4734873f084941970894c6090408b079c61b2e1c06d1", size = 20053, upload-time = "2024-07-29T01:09:00.465Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/5d/85/9ebeae2f76e9e77b952f4b274c27238156eae7979c5421fba91a28f4970d/sphinxcontrib_applehelp-2.0.0-py3-none-any.whl", hash = "sha256:4cd3f0ec4ac5dd9c17ec65e9ab272c9b867ea77425228e68ecf08d6b28ddbdb5", size = 119300, upload-time = "2024-07-29T01:08:58.99Z" }, +] + +[[package]] +name = "sphinxcontrib-devhelp" +version = "2.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/f6/d2/5beee64d3e4e747f316bae86b55943f51e82bb86ecd325883ef65741e7da/sphinxcontrib_devhelp-2.0.0.tar.gz", hash = "sha256:411f5d96d445d1d73bb5d52133377b4248ec79db5c793ce7dbe59e074b4dd1ad", size = 12967, upload-time = "2024-07-29T01:09:23.417Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/35/7a/987e583882f985fe4d7323774889ec58049171828b58c2217e7f79cdf44e/sphinxcontrib_devhelp-2.0.0-py3-none-any.whl", hash = "sha256:aefb8b83854e4b0998877524d1029fd3e6879210422ee3780459e28a1f03a8a2", size = 82530, upload-time = "2024-07-29T01:09:21.945Z" }, +] + +[[package]] +name = "sphinxcontrib-htmlhelp" +version = "2.1.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/43/93/983afd9aa001e5201eab16b5a444ed5b9b0a7a010541e0ddfbbfd0b2470c/sphinxcontrib_htmlhelp-2.1.0.tar.gz", hash = "sha256:c9e2916ace8aad64cc13a0d233ee22317f2b9025b9cf3295249fa985cc7082e9", size = 22617, upload-time = "2024-07-29T01:09:37.889Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/0a/7b/18a8c0bcec9182c05a0b3ec2a776bba4ead82750a55ff798e8d406dae604/sphinxcontrib_htmlhelp-2.1.0-py3-none-any.whl", hash = "sha256:166759820b47002d22914d64a075ce08f4c46818e17cfc9470a9786b759b19f8", size = 98705, upload-time = "2024-07-29T01:09:36.407Z" }, +] + +[[package]] +name = "sphinxcontrib-jquery" +version = "4.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "sphinx", version = "9.0.4", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version < '3.12'" }, + { name = "sphinx", version = "9.1.0", source = { registry = "https://pypi.org/simple" }, marker = "python_full_version >= '3.12'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/de/f3/aa67467e051df70a6330fe7770894b3e4f09436dea6881ae0b4f3d87cad8/sphinxcontrib-jquery-4.1.tar.gz", hash = "sha256:1620739f04e36a2c779f1a131a2dfd49b2fd07351bf1968ced074365933abc7a", size = 122331, upload-time = "2023-03-14T15:01:01.944Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/76/85/749bd22d1a68db7291c89e2ebca53f4306c3f205853cf31e9de279034c3c/sphinxcontrib_jquery-4.1-py2.py3-none-any.whl", hash = "sha256:f936030d7d0147dd026a4f2b5a57343d233f1fc7b363f68b3d4f1cb0993878ae", size = 121104, upload-time = "2023-03-14T15:01:00.356Z" }, +] + +[[package]] +name = "sphinxcontrib-jsmath" +version = "1.0.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/b2/e8/9ed3830aeed71f17c026a07a5097edcf44b692850ef215b161b8ad875729/sphinxcontrib-jsmath-1.0.1.tar.gz", hash = "sha256:a9925e4a4587247ed2191a22df5f6970656cb8ca2bd6284309578f2153e0c4b8", size = 5787, upload-time = "2019-01-21T16:10:16.347Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c2/42/4c8646762ee83602e3fb3fbe774c2fac12f317deb0b5dbeeedd2d3ba4b77/sphinxcontrib_jsmath-1.0.1-py2.py3-none-any.whl", hash = "sha256:2ec2eaebfb78f3f2078e73666b1415417a116cc848b72e5172e596c871103178", size = 5071, upload-time = "2019-01-21T16:10:14.333Z" }, +] + +[[package]] +name = "sphinxcontrib-qthelp" +version = "2.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/68/bc/9104308fc285eb3e0b31b67688235db556cd5b0ef31d96f30e45f2e51cae/sphinxcontrib_qthelp-2.0.0.tar.gz", hash = "sha256:4fe7d0ac8fc171045be623aba3e2a8f613f8682731f9153bb2e40ece16b9bbab", size = 17165, upload-time = "2024-07-29T01:09:56.435Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/27/83/859ecdd180cacc13b1f7e857abf8582a64552ea7a061057a6c716e790fce/sphinxcontrib_qthelp-2.0.0-py3-none-any.whl", hash = "sha256:b18a828cdba941ccd6ee8445dbe72ffa3ef8cbe7505d8cd1fa0d42d3f2d5f3eb", size = 88743, upload-time = "2024-07-29T01:09:54.885Z" }, +] + +[[package]] +name = "sphinxcontrib-serializinghtml" +version = "2.0.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/3b/44/6716b257b0aa6bfd51a1b31665d1c205fb12cb5ad56de752dfa15657de2f/sphinxcontrib_serializinghtml-2.0.0.tar.gz", hash = "sha256:e9d912827f872c029017a53f0ef2180b327c3f7fd23c87229f7a8e8b70031d4d", size = 16080, upload-time = "2024-07-29T01:10:09.332Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/52/a7/d2782e4e3f77c8450f727ba74a8f12756d5ba823d81b941f1b04da9d033a/sphinxcontrib_serializinghtml-2.0.0-py3-none-any.whl", hash = "sha256:6e2cb0eef194e10c27ec0023bfeb25badbbb5868244cf5bc5bdc04e4464bf331", size = 92072, upload-time = "2024-07-29T01:10:08.203Z" }, +] + +[[package]] +name = "sqlalchemy" +version = "2.0.46" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "greenlet", marker = "platform_machine == 'AMD64' or platform_machine == 'WIN32' or platform_machine == 'aarch64' or platform_machine == 'amd64' or platform_machine == 'ppc64le' or platform_machine == 'win32' or platform_machine == 'x86_64'" }, + { name = "typing-extensions" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/06/aa/9ce0f3e7a9829ead5c8ce549392f33a12c4555a6c0609bb27d882e9c7ddf/sqlalchemy-2.0.46.tar.gz", hash = "sha256:cf36851ee7219c170bb0793dbc3da3e80c582e04a5437bc601bfe8c85c9216d7", size = 9865393, upload-time = "2026-01-21T18:03:45.119Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/69/ac/b42ad16800d0885105b59380ad69aad0cce5a65276e269ce2729a2343b6a/sqlalchemy-2.0.46-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:261c4b1f101b4a411154f1da2b76497d73abbfc42740029205d4d01fa1052684", size = 2154851, upload-time = "2026-01-21T18:27:30.54Z" }, + { url = "https://files.pythonhosted.org/packages/a0/60/d8710068cb79f64d002ebed62a7263c00c8fd95f4ebd4b5be8f7ca93f2bc/sqlalchemy-2.0.46-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:181903fe8c1b9082995325f1b2e84ac078b1189e2819380c2303a5f90e114a62", size = 3311241, upload-time = "2026-01-21T18:32:33.45Z" }, + { url = "https://files.pythonhosted.org/packages/2b/0f/20c71487c7219ab3aa7421c7c62d93824c97c1460f2e8bb72404b0192d13/sqlalchemy-2.0.46-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:590be24e20e2424a4c3c1b0835e9405fa3d0af5823a1a9fc02e5dff56471515f", size = 3310741, upload-time = "2026-01-21T18:44:57.887Z" }, + { url = "https://files.pythonhosted.org/packages/65/80/d26d00b3b249ae000eee4db206fcfc564bf6ca5030e4747adf451f4b5108/sqlalchemy-2.0.46-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:7568fe771f974abadce52669ef3a03150ff03186d8eb82613bc8adc435a03f01", size = 3263116, upload-time = "2026-01-21T18:32:35.044Z" }, + { url = "https://files.pythonhosted.org/packages/da/ee/74dda7506640923821340541e8e45bd3edd8df78664f1f2e0aae8077192b/sqlalchemy-2.0.46-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:ebf7e1e78af38047e08836d33502c7a278915698b7c2145d045f780201679999", size = 3285327, upload-time = "2026-01-21T18:44:59.254Z" }, + { url = "https://files.pythonhosted.org/packages/9f/25/6dcf8abafff1389a21c7185364de145107b7394ecdcb05233815b236330d/sqlalchemy-2.0.46-cp311-cp311-win32.whl", hash = "sha256:9d80ea2ac519c364a7286e8d765d6cd08648f5b21ca855a8017d9871f075542d", size = 2114564, upload-time = "2026-01-21T18:33:15.85Z" }, + { url = "https://files.pythonhosted.org/packages/93/5f/e081490f8523adc0088f777e4ebad3cac21e498ec8a3d4067074e21447a1/sqlalchemy-2.0.46-cp311-cp311-win_amd64.whl", hash = "sha256:585af6afe518732d9ccd3aea33af2edaae4a7aa881af5d8f6f4fe3a368699597", size = 2139233, upload-time = "2026-01-21T18:33:17.528Z" }, + { url = "https://files.pythonhosted.org/packages/b6/35/d16bfa235c8b7caba3730bba43e20b1e376d2224f407c178fbf59559f23e/sqlalchemy-2.0.46-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:3a9a72b0da8387f15d5810f1facca8f879de9b85af8c645138cba61ea147968c", size = 2153405, upload-time = "2026-01-21T19:05:54.143Z" }, + { url = "https://files.pythonhosted.org/packages/06/6c/3192e24486749862f495ddc6584ed730c0c994a67550ec395d872a2ad650/sqlalchemy-2.0.46-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:2347c3f0efc4de367ba00218e0ae5c4ba2306e47216ef80d6e31761ac97cb0b9", size = 3334702, upload-time = "2026-01-21T18:46:45.384Z" }, + { url = "https://files.pythonhosted.org/packages/ea/a2/b9f33c8d68a3747d972a0bb758c6b63691f8fb8a49014bc3379ba15d4274/sqlalchemy-2.0.46-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9094c8b3197db12aa6f05c51c05daaad0a92b8c9af5388569847b03b1007fb1b", size = 3347664, upload-time = "2026-01-21T18:40:09.979Z" }, + { url = "https://files.pythonhosted.org/packages/aa/d2/3e59e2a91eaec9db7e8dc6b37b91489b5caeb054f670f32c95bcba98940f/sqlalchemy-2.0.46-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:37fee2164cf21417478b6a906adc1a91d69ae9aba8f9533e67ce882f4bb1de53", size = 3277372, upload-time = "2026-01-21T18:46:47.168Z" }, + { url = "https://files.pythonhosted.org/packages/dd/dd/67bc2e368b524e2192c3927b423798deda72c003e73a1e94c21e74b20a85/sqlalchemy-2.0.46-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:b1e14b2f6965a685c7128bd315e27387205429c2e339eeec55cb75ca4ab0ea2e", size = 3312425, upload-time = "2026-01-21T18:40:11.548Z" }, + { url = "https://files.pythonhosted.org/packages/43/82/0ecd68e172bfe62247e96cb47867c2d68752566811a4e8c9d8f6e7c38a65/sqlalchemy-2.0.46-cp312-cp312-win32.whl", hash = "sha256:412f26bb4ba942d52016edc8d12fb15d91d3cd46b0047ba46e424213ad407bcb", size = 2113155, upload-time = "2026-01-21T18:42:49.748Z" }, + { url = "https://files.pythonhosted.org/packages/bc/2a/2821a45742073fc0331dc132552b30de68ba9563230853437cac54b2b53e/sqlalchemy-2.0.46-cp312-cp312-win_amd64.whl", hash = "sha256:ea3cd46b6713a10216323cda3333514944e510aa691c945334713fca6b5279ff", size = 2140078, upload-time = "2026-01-21T18:42:51.197Z" }, + { url = "https://files.pythonhosted.org/packages/b3/4b/fa7838fe20bb752810feed60e45625a9a8b0102c0c09971e2d1d95362992/sqlalchemy-2.0.46-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:93a12da97cca70cea10d4b4fc602589c4511f96c1f8f6c11817620c021d21d00", size = 2150268, upload-time = "2026-01-21T19:05:56.621Z" }, + { url = "https://files.pythonhosted.org/packages/46/c1/b34dccd712e8ea846edf396e00973dda82d598cb93762e55e43e6835eba9/sqlalchemy-2.0.46-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:af865c18752d416798dae13f83f38927c52f085c52e2f32b8ab0fef46fdd02c2", size = 3276511, upload-time = "2026-01-21T18:46:49.022Z" }, + { url = "https://files.pythonhosted.org/packages/96/48/a04d9c94753e5d5d096c628c82a98c4793b9c08ca0e7155c3eb7d7db9f24/sqlalchemy-2.0.46-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:8d679b5f318423eacb61f933a9a0f75535bfca7056daeadbf6bd5bcee6183aee", size = 3292881, upload-time = "2026-01-21T18:40:13.089Z" }, + { url = "https://files.pythonhosted.org/packages/be/f4/06eda6e91476f90a7d8058f74311cb65a2fb68d988171aced81707189131/sqlalchemy-2.0.46-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:64901e08c33462acc9ec3bad27fc7a5c2b6491665f2aa57564e57a4f5d7c52ad", size = 3224559, upload-time = "2026-01-21T18:46:50.974Z" }, + { url = "https://files.pythonhosted.org/packages/ab/a2/d2af04095412ca6345ac22b33b89fe8d6f32a481e613ffcb2377d931d8d0/sqlalchemy-2.0.46-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:e8ac45e8f4eaac0f9f8043ea0e224158855c6a4329fd4ee37c45c61e3beb518e", size = 3262728, upload-time = "2026-01-21T18:40:14.883Z" }, + { url = "https://files.pythonhosted.org/packages/31/48/1980c7caa5978a3b8225b4d230e69a2a6538a3562b8b31cea679b6933c83/sqlalchemy-2.0.46-cp313-cp313-win32.whl", hash = "sha256:8d3b44b3d0ab2f1319d71d9863d76eeb46766f8cf9e921ac293511804d39813f", size = 2111295, upload-time = "2026-01-21T18:42:52.366Z" }, + { url = "https://files.pythonhosted.org/packages/2d/54/f8d65bbde3d877617c4720f3c9f60e99bb7266df0d5d78b6e25e7c149f35/sqlalchemy-2.0.46-cp313-cp313-win_amd64.whl", hash = "sha256:77f8071d8fbcbb2dd11b7fd40dedd04e8ebe2eb80497916efedba844298065ef", size = 2137076, upload-time = "2026-01-21T18:42:53.924Z" }, + { url = "https://files.pythonhosted.org/packages/56/ba/9be4f97c7eb2b9d5544f2624adfc2853e796ed51d2bb8aec90bc94b7137e/sqlalchemy-2.0.46-cp313-cp313t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:a1e8cc6cc01da346dc92d9509a63033b9b1bda4fed7a7a7807ed385c7dccdc10", size = 3556533, upload-time = "2026-01-21T18:33:06.636Z" }, + { url = "https://files.pythonhosted.org/packages/20/a6/b1fc6634564dbb4415b7ed6419cdfeaadefd2c39cdab1e3aa07a5f2474c2/sqlalchemy-2.0.46-cp313-cp313t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:96c7cca1a4babaaf3bfff3e4e606e38578856917e52f0384635a95b226c87764", size = 3523208, upload-time = "2026-01-21T18:45:08.436Z" }, + { url = "https://files.pythonhosted.org/packages/a1/d8/41e0bdfc0f930ff236f86fccd12962d8fa03713f17ed57332d38af6a3782/sqlalchemy-2.0.46-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:b2a9f9aee38039cf4755891a1e50e1effcc42ea6ba053743f452c372c3152b1b", size = 3464292, upload-time = "2026-01-21T18:33:08.208Z" }, + { url = "https://files.pythonhosted.org/packages/f0/8b/9dcbec62d95bea85f5ecad9b8d65b78cc30fb0ffceeb3597961f3712549b/sqlalchemy-2.0.46-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:db23b1bf8cfe1f7fda19018e7207b20cdb5168f83c437ff7e95d19e39289c447", size = 3473497, upload-time = "2026-01-21T18:45:10.552Z" }, + { url = "https://files.pythonhosted.org/packages/e9/f8/5ecdfc73383ec496de038ed1614de9e740a82db9ad67e6e4514ebc0708a3/sqlalchemy-2.0.46-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:56bdd261bfd0895452006d5316cbf35739c53b9bb71a170a331fa0ea560b2ada", size = 2152079, upload-time = "2026-01-21T19:05:58.477Z" }, + { url = "https://files.pythonhosted.org/packages/e5/bf/eba3036be7663ce4d9c050bc3d63794dc29fbe01691f2bf5ccb64e048d20/sqlalchemy-2.0.46-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:33e462154edb9493f6c3ad2125931e273bbd0be8ae53f3ecd1c161ea9a1dd366", size = 3272216, upload-time = "2026-01-21T18:46:52.634Z" }, + { url = "https://files.pythonhosted.org/packages/05/45/1256fb597bb83b58a01ddb600c59fe6fdf0e5afe333f0456ed75c0f8d7bd/sqlalchemy-2.0.46-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:9bcdce05f056622a632f1d44bb47dbdb677f58cad393612280406ce37530eb6d", size = 3277208, upload-time = "2026-01-21T18:40:16.38Z" }, + { url = "https://files.pythonhosted.org/packages/d9/a0/2053b39e4e63b5d7ceb3372cface0859a067c1ddbd575ea7e9985716f771/sqlalchemy-2.0.46-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:8e84b09a9b0f19accedcbeff5c2caf36e0dd537341a33aad8d680336152dc34e", size = 3221994, upload-time = "2026-01-21T18:46:54.622Z" }, + { url = "https://files.pythonhosted.org/packages/1e/87/97713497d9502553c68f105a1cb62786ba1ee91dea3852ae4067ed956a50/sqlalchemy-2.0.46-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:4f52f7291a92381e9b4de9050b0a65ce5d6a763333406861e33906b8aa4906bf", size = 3243990, upload-time = "2026-01-21T18:40:18.253Z" }, + { url = "https://files.pythonhosted.org/packages/a8/87/5d1b23548f420ff823c236f8bea36b1a997250fd2f892e44a3838ca424f4/sqlalchemy-2.0.46-cp314-cp314-win32.whl", hash = "sha256:70ed2830b169a9960193f4d4322d22be5c0925357d82cbf485b3369893350908", size = 2114215, upload-time = "2026-01-21T18:42:55.232Z" }, + { url = "https://files.pythonhosted.org/packages/3a/20/555f39cbcf0c10cf452988b6a93c2a12495035f68b3dbd1a408531049d31/sqlalchemy-2.0.46-cp314-cp314-win_amd64.whl", hash = "sha256:3c32e993bc57be6d177f7d5d31edb93f30726d798ad86ff9066d75d9bf2e0b6b", size = 2139867, upload-time = "2026-01-21T18:42:56.474Z" }, + { url = "https://files.pythonhosted.org/packages/3e/f0/f96c8057c982d9d8a7a68f45d69c674bc6f78cad401099692fe16521640a/sqlalchemy-2.0.46-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:4dafb537740eef640c4d6a7c254611dca2df87eaf6d14d6a5fca9d1f4c3fc0fa", size = 3561202, upload-time = "2026-01-21T18:33:10.337Z" }, + { url = "https://files.pythonhosted.org/packages/d7/53/3b37dda0a5b137f21ef608d8dfc77b08477bab0fe2ac9d3e0a66eaeab6fc/sqlalchemy-2.0.46-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:42a1643dc5427b69aca967dae540a90b0fbf57eaf248f13a90ea5930e0966863", size = 3526296, upload-time = "2026-01-21T18:45:12.657Z" }, + { url = "https://files.pythonhosted.org/packages/33/75/f28622ba6dde79cd545055ea7bd4062dc934e0621f7b3be2891f8563f8de/sqlalchemy-2.0.46-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:ff33c6e6ad006bbc0f34f5faf941cfc62c45841c64c0a058ac38c799f15b5ede", size = 3470008, upload-time = "2026-01-21T18:33:11.725Z" }, + { url = "https://files.pythonhosted.org/packages/a9/42/4afecbbc38d5e99b18acef446453c76eec6fbd03db0a457a12a056836e22/sqlalchemy-2.0.46-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:82ec52100ec1e6ec671563bbd02d7c7c8d0b9e71a0723c72f22ecf52d1755330", size = 3476137, upload-time = "2026-01-21T18:45:15.001Z" }, + { url = "https://files.pythonhosted.org/packages/fc/a1/9c4efa03300926601c19c18582531b45aededfb961ab3c3585f1e24f120b/sqlalchemy-2.0.46-py3-none-any.whl", hash = "sha256:f9c11766e7e7c0a2767dda5acb006a118640c9fc0a4104214b96269bfb78399e", size = 1937882, upload-time = "2026-01-21T18:22:10.456Z" }, +] + +[[package]] +name = "stack-data" +version = "0.6.3" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "asttokens" }, + { name = "executing" }, + { name = "pure-eval" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/28/e3/55dcc2cfbc3ca9c29519eb6884dd1415ecb53b0e934862d3559ddcb7e20b/stack_data-0.6.3.tar.gz", hash = "sha256:836a778de4fec4dcd1dcd89ed8abff8a221f58308462e1c4aa2a3cf30148f0b9", size = 44707, upload-time = "2023-09-30T13:58:05.479Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f1/7b/ce1eafaf1a76852e2ec9b22edecf1daa58175c090266e9f6c64afcd81d91/stack_data-0.6.3-py3-none-any.whl", hash = "sha256:d5558e0c25a4cb0853cddad3d77da9891a08cb85dd9f9f91b9f8cd66e511e695", size = 24521, upload-time = "2023-09-30T13:58:03.53Z" }, +] + +[[package]] +name = "starlette" +version = "1.3.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "anyio" }, + { name = "typing-extensions", marker = "python_full_version < '3.13'" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/eb/e3/7c1dc7381d9f8ab7d854328ebfa884e62cb3f3d8549ddfd37c7814f42afa/starlette-1.3.1.tar.gz", hash = "sha256:05d0213193f2fbaae60e2ecb593b4add4262ad4e46536b54abe36f11a71724e0", size = 2703240, upload-time = "2026-06-12T09:23:11.602Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ec/bb/2799cc2ede3ed41131f8975621e7213dfc7ef4acbbaadfa440f32500c370/starlette-1.3.1-py3-none-any.whl", hash = "sha256:c7372aae11c3c3f26a42df7bd626cec2f47d03483d261d369516a615a53714c6", size = 73632, upload-time = "2026-06-12T09:23:10.017Z" }, +] + +[[package]] +name = "sympy" +version = "1.14.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "mpmath" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/83/d3/803453b36afefb7c2bb238361cd4ae6125a569b4db67cd9e79846ba2d68c/sympy-1.14.0.tar.gz", hash = "sha256:d3d3fe8df1e5a0b42f0e7bdf50541697dbe7d23746e894990c030e2b05e72517", size = 7793921, upload-time = "2025-04-27T18:05:01.611Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/a2/09/77d55d46fd61b4a135c444fc97158ef34a095e5681d0a6c10b75bf356191/sympy-1.14.0-py3-none-any.whl", hash = "sha256:e091cc3e99d2141a0ba2847328f5479b05d94a6635cb96148ccb3f34671bd8f5", size = 6299353, upload-time = "2025-04-27T18:04:59.103Z" }, +] + +[[package]] +name = "tenacity" +version = "9.1.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/47/c6/ee486fd809e357697ee8a44d3d69222b344920433d3b6666ccd9b374630c/tenacity-9.1.4.tar.gz", hash = "sha256:adb31d4c263f2bd041081ab33b498309a57c77f9acf2db65aadf0898179cf93a", size = 49413, upload-time = "2026-02-07T10:45:33.841Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/d7/c1/eb8f9debc45d3b7918a32ab756658a0904732f75e555402972246b0b8e71/tenacity-9.1.4-py3-none-any.whl", hash = "sha256:6095a360c919085f28c6527de529e76a06ad89b23659fa881ae0649b867a9d55", size = 28926, upload-time = "2026-02-07T10:45:32.24Z" }, +] + +[[package]] +name = "threadpoolctl" +version = "3.6.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/b7/4d/08c89e34946fce2aec4fbb45c9016efd5f4d7f24af8e5d93296e935631d8/threadpoolctl-3.6.0.tar.gz", hash = "sha256:8ab8b4aa3491d812b623328249fab5302a68d2d71745c8a4c719a2fcaba9f44e", size = 21274, upload-time = "2025-03-13T13:49:23.031Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/32/d5/f9a850d79b0851d1d4ef6456097579a9005b31fea68726a4ae5f2d82ddd9/threadpoolctl-3.6.0-py3-none-any.whl", hash = "sha256:43a0b8fd5a2928500110039e43a5eed8480b918967083ea48dc3ab9f13c4a7fb", size = 18638, upload-time = "2025-03-13T13:49:21.846Z" }, +] + +[[package]] +name = "tinycss2" +version = "1.5.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "webencodings" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/a3/ae/2ca4913e5c0f09781d75482874c3a95db9105462a92ddd303c7d285d3df2/tinycss2-1.5.1.tar.gz", hash = "sha256:d339d2b616ba90ccce58da8495a78f46e55d4d25f9fd71dfd526f07e7d53f957", size = 88195, upload-time = "2025-11-23T10:29:10.082Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/60/45/c7b5c3168458db837e8ceab06dc77824e18202679d0463f0e8f002143a97/tinycss2-1.5.1-py3-none-any.whl", hash = "sha256:3415ba0f5839c062696996998176c4a3751d18b7edaaeeb658c9ce21ec150661", size = 28404, upload-time = "2025-11-23T10:29:08.676Z" }, +] + +[[package]] +name = "torch" +version = "2.10.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "cuda-bindings", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "filelock" }, + { name = "fsspec" }, + { name = "jinja2" }, + { name = "networkx" }, + { name = "nvidia-cublas-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cuda-cupti-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cuda-nvrtc-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cuda-runtime-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cudnn-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cufft-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cufile-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-curand-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cusolver-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cusparse-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-cusparselt-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-nccl-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-nvjitlink-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-nvshmem-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "nvidia-nvtx-cu12", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "setuptools", marker = "python_full_version >= '3.12'" }, + { name = "sympy" }, + { name = "triton", marker = "platform_machine == 'x86_64' and sys_platform == 'linux'" }, + { name = "typing-extensions" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/0f/8b/4b61d6e13f7108f36910df9ab4b58fd389cc2520d54d81b88660804aad99/torch-2.10.0-2-cp311-none-macosx_11_0_arm64.whl", hash = "sha256:418997cb02d0a0f1497cf6a09f63166f9f5df9f3e16c8a716ab76a72127c714f", size = 79423467, upload-time = "2026-02-10T21:44:48.711Z" }, + { url = "https://files.pythonhosted.org/packages/d3/54/a2ba279afcca44bbd320d4e73675b282fcee3d81400ea1b53934efca6462/torch-2.10.0-2-cp312-none-macosx_11_0_arm64.whl", hash = "sha256:13ec4add8c3faaed8d13e0574f5cd4a323c11655546f91fbe6afa77b57423574", size = 79498202, upload-time = "2026-02-10T21:44:52.603Z" }, + { url = "https://files.pythonhosted.org/packages/ec/23/2c9fe0c9c27f7f6cb865abcea8a4568f29f00acaeadfc6a37f6801f84cb4/torch-2.10.0-2-cp313-none-macosx_11_0_arm64.whl", hash = "sha256:e521c9f030a3774ed770a9c011751fb47c4d12029a3d6522116e48431f2ff89e", size = 79498254, upload-time = "2026-02-10T21:44:44.095Z" }, + { url = "https://files.pythonhosted.org/packages/36/ab/7b562f1808d3f65414cd80a4f7d4bb00979d9355616c034c171249e1a303/torch-2.10.0-3-cp311-cp311-manylinux_2_28_x86_64.whl", hash = "sha256:ac5bdcbb074384c66fa160c15b1ead77839e3fe7ed117d667249afce0acabfac", size = 915518691, upload-time = "2026-03-11T14:15:43.147Z" }, + { url = "https://files.pythonhosted.org/packages/b3/7a/abada41517ce0011775f0f4eacc79659bc9bc6c361e6bfe6f7052a6b9363/torch-2.10.0-3-cp312-cp312-manylinux_2_28_x86_64.whl", hash = "sha256:98c01b8bb5e3240426dcde1446eed6f40c778091c8544767ef1168fc663a05a6", size = 915622781, upload-time = "2026-03-11T14:17:11.354Z" }, + { url = "https://files.pythonhosted.org/packages/ab/c6/4dfe238342ffdcec5aef1c96c457548762d33c40b45a1ab7033bb26d2ff2/torch-2.10.0-3-cp313-cp313-manylinux_2_28_x86_64.whl", hash = "sha256:80b1b5bfe38eb0e9f5ff09f206dcac0a87aadd084230d4a36eea5ec5232c115b", size = 915627275, upload-time = "2026-03-11T14:16:11.325Z" }, + { url = "https://files.pythonhosted.org/packages/d8/f0/72bf18847f58f877a6a8acf60614b14935e2f156d942483af1ffc081aea0/torch-2.10.0-3-cp313-cp313t-manylinux_2_28_x86_64.whl", hash = "sha256:46b3574d93a2a8134b3f5475cfb98e2eb46771794c57015f6ad1fb795ec25e49", size = 915523474, upload-time = "2026-03-11T14:17:44.422Z" }, + { url = "https://files.pythonhosted.org/packages/f4/39/590742415c3030551944edc2ddc273ea1fdfe8ffb2780992e824f1ebee98/torch-2.10.0-3-cp314-cp314-manylinux_2_28_x86_64.whl", hash = "sha256:b1d5e2aba4eb7f8e87fbe04f86442887f9167a35f092afe4c237dfcaaef6e328", size = 915632474, upload-time = "2026-03-11T14:15:13.666Z" }, + { url = "https://files.pythonhosted.org/packages/b6/8e/34949484f764dde5b222b7fe3fede43e4a6f0da9d7f8c370bb617d629ee2/torch-2.10.0-3-cp314-cp314t-manylinux_2_28_x86_64.whl", hash = "sha256:0228d20b06701c05a8f978357f657817a4a63984b0c90745def81c18aedfa591", size = 915523882, upload-time = "2026-03-11T14:14:46.311Z" }, + { url = "https://files.pythonhosted.org/packages/78/89/f5554b13ebd71e05c0b002f95148033e730d3f7067f67423026cc9c69410/torch-2.10.0-cp311-cp311-manylinux_2_28_aarch64.whl", hash = "sha256:3282d9febd1e4e476630a099692b44fdc214ee9bf8ee5377732d9d9dfe5712e4", size = 145992610, upload-time = "2026-01-21T16:25:26.327Z" }, + { url = "https://files.pythonhosted.org/packages/ae/30/a3a2120621bf9c17779b169fc17e3dc29b230c29d0f8222f499f5e159aa8/torch-2.10.0-cp311-cp311-manylinux_2_28_x86_64.whl", hash = "sha256:a2f9edd8dbc99f62bc4dfb78af7bf89499bca3d753423ac1b4e06592e467b763", size = 915607863, upload-time = "2026-01-21T16:25:06.696Z" }, + { url = "https://files.pythonhosted.org/packages/6f/3d/c87b33c5f260a2a8ad68da7147e105f05868c281c63d65ed85aa4da98c66/torch-2.10.0-cp311-cp311-win_amd64.whl", hash = "sha256:29b7009dba4b7a1c960260fc8ac85022c784250af43af9fb0ebafc9883782ebd", size = 113723116, upload-time = "2026-01-21T16:25:21.916Z" }, + { url = "https://files.pythonhosted.org/packages/61/d8/15b9d9d3a6b0c01b883787bd056acbe5cc321090d4b216d3ea89a8fcfdf3/torch-2.10.0-cp311-none-macosx_11_0_arm64.whl", hash = "sha256:b7bd80f3477b830dd166c707c5b0b82a898e7b16f59a7d9d42778dd058272e8b", size = 79423461, upload-time = "2026-01-21T16:24:50.266Z" }, + { url = "https://files.pythonhosted.org/packages/cc/af/758e242e9102e9988969b5e621d41f36b8f258bb4a099109b7a4b4b50ea4/torch-2.10.0-cp312-cp312-manylinux_2_28_aarch64.whl", hash = "sha256:5fd4117d89ffd47e3dcc71e71a22efac24828ad781c7e46aaaf56bf7f2796acf", size = 145996088, upload-time = "2026-01-21T16:24:44.171Z" }, + { url = "https://files.pythonhosted.org/packages/23/8e/3c74db5e53bff7ed9e34c8123e6a8bfef718b2450c35eefab85bb4a7e270/torch-2.10.0-cp312-cp312-manylinux_2_28_x86_64.whl", hash = "sha256:787124e7db3b379d4f1ed54dd12ae7c741c16a4d29b49c0226a89bea50923ffb", size = 915711952, upload-time = "2026-01-21T16:23:53.503Z" }, + { url = "https://files.pythonhosted.org/packages/6e/01/624c4324ca01f66ae4c7cd1b74eb16fb52596dce66dbe51eff95ef9e7a4c/torch-2.10.0-cp312-cp312-win_amd64.whl", hash = "sha256:2c66c61f44c5f903046cc696d088e21062644cbe541c7f1c4eaae88b2ad23547", size = 113757972, upload-time = "2026-01-21T16:24:39.516Z" }, + { url = "https://files.pythonhosted.org/packages/c9/5c/dee910b87c4d5c0fcb41b50839ae04df87c1cfc663cf1b5fca7ea565eeaa/torch-2.10.0-cp312-none-macosx_11_0_arm64.whl", hash = "sha256:6d3707a61863d1c4d6ebba7be4ca320f42b869ee657e9b2c21c736bf17000294", size = 79498198, upload-time = "2026-01-21T16:24:34.704Z" }, + { url = "https://files.pythonhosted.org/packages/c9/6f/f2e91e34e3fcba2e3fc8d8f74e7d6c22e74e480bbd1db7bc8900fdf3e95c/torch-2.10.0-cp313-cp313-manylinux_2_28_aarch64.whl", hash = "sha256:5c4d217b14741e40776dd7074d9006fd28b8a97ef5654db959d8635b2fe5f29b", size = 146004247, upload-time = "2026-01-21T16:24:29.335Z" }, + { url = "https://files.pythonhosted.org/packages/98/fb/5160261aeb5e1ee12ee95fe599d0541f7c976c3701d607d8fc29e623229f/torch-2.10.0-cp313-cp313-manylinux_2_28_x86_64.whl", hash = "sha256:6b71486353fce0f9714ca0c9ef1c850a2ae766b409808acd58e9678a3edb7738", size = 915716445, upload-time = "2026-01-21T16:22:45.353Z" }, + { url = "https://files.pythonhosted.org/packages/6a/16/502fb1b41e6d868e8deb5b0e3ae926bbb36dab8ceb0d1b769b266ad7b0c3/torch-2.10.0-cp313-cp313-win_amd64.whl", hash = "sha256:c2ee399c644dc92ef7bc0d4f7e74b5360c37cdbe7c5ba11318dda49ffac2bc57", size = 113757050, upload-time = "2026-01-21T16:24:19.204Z" }, + { url = "https://files.pythonhosted.org/packages/1a/0b/39929b148f4824bc3ad6f9f72a29d4ad865bcf7ebfc2fa67584773e083d2/torch-2.10.0-cp313-cp313t-macosx_14_0_arm64.whl", hash = "sha256:3202429f58309b9fa96a614885eace4b7995729f44beb54d3e4a47773649d382", size = 79851305, upload-time = "2026-01-21T16:24:09.209Z" }, + { url = "https://files.pythonhosted.org/packages/d8/14/21fbce63bc452381ba5f74a2c0a959fdf5ad5803ccc0c654e752e0dbe91a/torch-2.10.0-cp313-cp313t-manylinux_2_28_aarch64.whl", hash = "sha256:aae1b29cd68e50a9397f5ee897b9c24742e9e306f88a807a27d617f07adb3bd8", size = 146005472, upload-time = "2026-01-21T16:22:29.022Z" }, + { url = "https://files.pythonhosted.org/packages/54/fd/b207d1c525cb570ef47f3e9f836b154685011fce11a2f444ba8a4084d042/torch-2.10.0-cp313-cp313t-manylinux_2_28_x86_64.whl", hash = "sha256:6021db85958db2f07ec94e1bc77212721ba4920c12a18dc552d2ae36a3eb163f", size = 915612644, upload-time = "2026-01-21T16:21:47.019Z" }, + { url = "https://files.pythonhosted.org/packages/36/53/0197f868c75f1050b199fe58f9bf3bf3aecac9b4e85cc9c964383d745403/torch-2.10.0-cp313-cp313t-win_amd64.whl", hash = "sha256:ff43db38af76fda183156153983c9a096fc4c78d0cd1e07b14a2314c7f01c2c8", size = 113997015, upload-time = "2026-01-21T16:23:00.767Z" }, + { url = "https://files.pythonhosted.org/packages/0e/13/e76b4d9c160e89fff48bf16b449ea324bda84745d2ab30294c37c2434c0d/torch-2.10.0-cp313-none-macosx_11_0_arm64.whl", hash = "sha256:cdf2a523d699b70d613243211ecaac14fe9c5df8a0b0a9c02add60fb2a413e0f", size = 79498248, upload-time = "2026-01-21T16:23:09.315Z" }, + { url = "https://files.pythonhosted.org/packages/4f/93/716b5ac0155f1be70ed81bacc21269c3ece8dba0c249b9994094110bfc51/torch-2.10.0-cp314-cp314-macosx_14_0_arm64.whl", hash = "sha256:bf0d9ff448b0218e0433aeb198805192346c4fd659c852370d5cc245f602a06a", size = 79464992, upload-time = "2026-01-21T16:23:05.162Z" }, + { url = "https://files.pythonhosted.org/packages/69/2b/51e663ff190c9d16d4a8271203b71bc73a16aa7619b9f271a69b9d4a936b/torch-2.10.0-cp314-cp314-manylinux_2_28_aarch64.whl", hash = "sha256:233aed0659a2503b831d8a67e9da66a62c996204c0bba4f4c442ccc0c68a3f60", size = 146018567, upload-time = "2026-01-21T16:22:23.393Z" }, + { url = "https://files.pythonhosted.org/packages/5e/cd/4b95ef7f293b927c283db0b136c42be91c8ec6845c44de0238c8c23bdc80/torch-2.10.0-cp314-cp314-manylinux_2_28_x86_64.whl", hash = "sha256:682497e16bdfa6efeec8cde66531bc8d1fbbbb4d8788ec6173c089ed3cc2bfe5", size = 915721646, upload-time = "2026-01-21T16:21:16.983Z" }, + { url = "https://files.pythonhosted.org/packages/56/97/078a007208f8056d88ae43198833469e61a0a355abc0b070edd2c085eb9a/torch-2.10.0-cp314-cp314-win_amd64.whl", hash = "sha256:6528f13d2a8593a1a412ea07a99812495bec07e9224c28b2a25c0a30c7da025c", size = 113752373, upload-time = "2026-01-21T16:22:13.471Z" }, + { url = "https://files.pythonhosted.org/packages/d8/94/71994e7d0d5238393df9732fdab607e37e2b56d26a746cb59fdb415f8966/torch-2.10.0-cp314-cp314t-macosx_14_0_arm64.whl", hash = "sha256:f5ab4ba32383061be0fb74bda772d470140a12c1c3b58a0cfbf3dae94d164c28", size = 79850324, upload-time = "2026-01-21T16:22:09.494Z" }, + { url = "https://files.pythonhosted.org/packages/e2/65/1a05346b418ea8ccd10360eef4b3e0ce688fba544e76edec26913a8d0ee0/torch-2.10.0-cp314-cp314t-manylinux_2_28_aarch64.whl", hash = "sha256:716b01a176c2a5659c98f6b01bf868244abdd896526f1c692712ab36dbaf9b63", size = 146006482, upload-time = "2026-01-21T16:22:18.42Z" }, + { url = "https://files.pythonhosted.org/packages/1d/b9/5f6f9d9e859fc3235f60578fa64f52c9c6e9b4327f0fe0defb6de5c0de31/torch-2.10.0-cp314-cp314t-manylinux_2_28_x86_64.whl", hash = "sha256:d8f5912ba938233f86361e891789595ff35ca4b4e2ac8fe3670895e5976731d6", size = 915613050, upload-time = "2026-01-21T16:20:49.035Z" }, + { url = "https://files.pythonhosted.org/packages/66/4d/35352043ee0eaffdeff154fad67cd4a31dbed7ff8e3be1cc4549717d6d51/torch-2.10.0-cp314-cp314t-win_amd64.whl", hash = "sha256:71283a373f0ee2c89e0f0d5f446039bdabe8dbc3c9ccf35f0f784908b0acd185", size = 113995816, upload-time = "2026-01-21T16:22:05.312Z" }, +] + +[[package]] +name = "torchvision" +version = "0.25.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "numpy" }, + { name = "pillow" }, + { name = "torch" }, +] +wheels = [ + { url = "https://files.pythonhosted.org/packages/3e/be/c704bceaf11c4f6b19d64337a34a877fcdfe3bd68160a8c9ae9bea4a35a3/torchvision-0.25.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:db74a551946b75d19f9996c419a799ffdf6a223ecf17c656f90da011f1d75b20", size = 1874923, upload-time = "2026-01-21T16:27:46.574Z" }, + { url = "https://files.pythonhosted.org/packages/ae/e9/f143cd71232430de1f547ceab840f68c55e127d72558b1061a71d0b193cd/torchvision-0.25.0-cp311-cp311-manylinux_2_28_aarch64.whl", hash = "sha256:f49964f96644dbac2506dffe1a0a7ec0f2bf8cf7a588c3319fed26e6329ffdf3", size = 2344808, upload-time = "2026-01-21T16:27:43.191Z" }, + { url = "https://files.pythonhosted.org/packages/43/ae/ad5d6165797de234c9658752acb4fce65b78a6a18d82efdf8367c940d8da/torchvision-0.25.0-cp311-cp311-manylinux_2_28_x86_64.whl", hash = "sha256:153c0d2cbc34b7cf2da19d73450f24ba36d2b75ec9211b9962b5022fb9e4ecee", size = 8070752, upload-time = "2026-01-21T16:27:33.748Z" }, + { url = "https://files.pythonhosted.org/packages/23/19/55b28aecdc7f38df57b8eb55eb0b14a62b470ed8efeb22cdc74224df1d6a/torchvision-0.25.0-cp311-cp311-win_amd64.whl", hash = "sha256:ea580ffd6094cc01914ad32f8c8118174f18974629af905cea08cb6d5d48c7b7", size = 4038722, upload-time = "2026-01-21T16:27:41.355Z" }, + { url = "https://files.pythonhosted.org/packages/56/3a/6ea0d73f49a9bef38a1b3a92e8dd455cea58470985d25635beab93841748/torchvision-0.25.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:c2abe430c90b1d5e552680037d68da4eb80a5852ebb1c811b2b89d299b10573b", size = 1874920, upload-time = "2026-01-21T16:27:45.348Z" }, + { url = "https://files.pythonhosted.org/packages/51/f8/c0e1ef27c66e15406fece94930e7d6feee4cb6374bbc02d945a630d6426e/torchvision-0.25.0-cp312-cp312-manylinux_2_28_aarch64.whl", hash = "sha256:b75deafa2dfea3e2c2a525559b04783515e3463f6e830cb71de0fb7ea36fe233", size = 2344556, upload-time = "2026-01-21T16:27:40.125Z" }, + { url = "https://files.pythonhosted.org/packages/68/2f/f24b039169db474e8688f649377de082a965fbf85daf4e46c44412f1d15a/torchvision-0.25.0-cp312-cp312-manylinux_2_28_x86_64.whl", hash = "sha256:f25aa9e380865b11ea6e9d99d84df86b9cc959f1a007cd966fc6f1ab2ed0e248", size = 8072351, upload-time = "2026-01-21T16:27:21.074Z" }, + { url = "https://files.pythonhosted.org/packages/ad/16/8f650c2e288977cf0f8f85184b90ee56ed170a4919347fc74ee99286ed6f/torchvision-0.25.0-cp312-cp312-win_amd64.whl", hash = "sha256:f9c55ae8d673ab493325d1267cbd285bb94d56f99626c00ac4644de32a59ede3", size = 4303059, upload-time = "2026-01-21T16:27:11.08Z" }, + { url = "https://files.pythonhosted.org/packages/f5/5b/1562a04a6a5a4cf8cf40016a0cdeda91ede75d6962cff7f809a85ae966a5/torchvision-0.25.0-cp313-cp313-macosx_12_0_arm64.whl", hash = "sha256:24e11199e4d84ba9c5ee7825ebdf1cd37ce8deec225117f10243cae984ced3ec", size = 1874918, upload-time = "2026-01-21T16:27:39.02Z" }, + { url = "https://files.pythonhosted.org/packages/36/b1/3d6c42f62c272ce34fcce609bb8939bdf873dab5f1b798fd4e880255f129/torchvision-0.25.0-cp313-cp313-manylinux_2_28_aarch64.whl", hash = "sha256:5f271136d2d2c0b7a24c5671795c6e4fd8da4e0ea98aeb1041f62bc04c4370ef", size = 2309106, upload-time = "2026-01-21T16:27:30.624Z" }, + { url = "https://files.pythonhosted.org/packages/c7/60/59bb9c8b67cce356daeed4cb96a717caa4f69c9822f72e223a0eae7a9bd9/torchvision-0.25.0-cp313-cp313-manylinux_2_28_x86_64.whl", hash = "sha256:855c0dc6d37f462482da7531c6788518baedca1e0847f3df42a911713acdfe52", size = 8071522, upload-time = "2026-01-21T16:27:29.392Z" }, + { url = "https://files.pythonhosted.org/packages/32/a5/9a9b1de0720f884ea50dbf9acb22cbe5312e51d7b8c4ac6ba9b51efd9bba/torchvision-0.25.0-cp313-cp313-win_amd64.whl", hash = "sha256:cef0196be31be421f6f462d1e9da1101be7332d91984caa6f8022e6c78a5877f", size = 4321911, upload-time = "2026-01-21T16:27:35.195Z" }, + { url = "https://files.pythonhosted.org/packages/52/99/dca81ed21ebaeff2b67cc9f815a20fdaa418b69f5f9ea4c6ed71721470db/torchvision-0.25.0-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:a8f8061284395ce31bcd460f2169013382ccf411148ceb2ee38e718e9860f5a7", size = 1896209, upload-time = "2026-01-21T16:27:32.159Z" }, + { url = "https://files.pythonhosted.org/packages/28/cc/2103149761fdb4eaed58a53e8437b2d716d48f05174fab1d9fcf1e2a2244/torchvision-0.25.0-cp313-cp313t-manylinux_2_28_aarch64.whl", hash = "sha256:146d02c9876858420adf41f3189fe90e3d6a409cbfa65454c09f25fb33bf7266", size = 2310735, upload-time = "2026-01-21T16:27:22.327Z" }, + { url = "https://files.pythonhosted.org/packages/76/ad/f4c985ad52ddd3b22711c588501be1b330adaeaf6850317f66751711b78c/torchvision-0.25.0-cp313-cp313t-manylinux_2_28_x86_64.whl", hash = "sha256:c4d395cb2c4a2712f6eb93a34476cdf7aae74bb6ea2ea1917f858e96344b00aa", size = 8089557, upload-time = "2026-01-21T16:27:27.666Z" }, + { url = "https://files.pythonhosted.org/packages/63/cc/0ea68b5802e5e3c31f44b307e74947bad5a38cc655231d845534ed50ddb8/torchvision-0.25.0-cp313-cp313t-win_amd64.whl", hash = "sha256:5e6b449e9fa7d642142c0e27c41e5a43b508d57ed8e79b7c0a0c28652da8678c", size = 4344260, upload-time = "2026-01-21T16:27:17.018Z" }, + { url = "https://files.pythonhosted.org/packages/9e/1f/fa839532660e2602b7e704d65010787c5bb296258b44fa8b9c1cd6175e7d/torchvision-0.25.0-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:620a236288d594dcec7634c754484542dc0a5c1b0e0b83a34bda5e91e9b7c3a1", size = 1896193, upload-time = "2026-01-21T16:27:24.785Z" }, + { url = "https://files.pythonhosted.org/packages/80/ed/d51889da7ceaf5ff7a0574fb28f9b6b223df19667265395891f81b364ab3/torchvision-0.25.0-cp314-cp314-manylinux_2_28_aarch64.whl", hash = "sha256:0b5e7f50002a8145a98c5694a018e738c50e2972608310c7e88e1bd4c058f6ce", size = 2309331, upload-time = "2026-01-21T16:27:19.97Z" }, + { url = "https://files.pythonhosted.org/packages/90/a5/f93fcffaddd8f12f9e812256830ec9c9ca65abbf1bc369379f9c364d1ff4/torchvision-0.25.0-cp314-cp314-manylinux_2_28_x86_64.whl", hash = "sha256:632db02300e83793812eee4f61ae6a2686dab10b4cfd628b620dc47747aa9d03", size = 8088713, upload-time = "2026-01-21T16:27:15.281Z" }, + { url = "https://files.pythonhosted.org/packages/1f/eb/d0096eed5690d962853213f2ee00d91478dfcb586b62dbbb449fb8abc3a6/torchvision-0.25.0-cp314-cp314-win_amd64.whl", hash = "sha256:d1abd5ed030c708f5dbf4812ad5f6fbe9384b63c40d6bd79f8df41a4a759a917", size = 4325058, upload-time = "2026-01-21T16:27:26.165Z" }, + { url = "https://files.pythonhosted.org/packages/97/36/96374a4c7ab50dea9787ce987815614ccfe988a42e10ac1a2e3e5b60319a/torchvision-0.25.0-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:ad9a8a5877782944d99186e4502a614770fe906626d76e9cd32446a0ac3075f2", size = 1896207, upload-time = "2026-01-21T16:27:23.383Z" }, + { url = "https://files.pythonhosted.org/packages/b5/e2/7abb10a867db79b226b41da419b63b69c0bd5b82438c4a4ed50e084c552f/torchvision-0.25.0-cp314-cp314t-manylinux_2_28_aarch64.whl", hash = "sha256:40a122c3cf4d14b651f095e0f672b688dde78632783fc5cd3d4d5e4f6a828563", size = 2310741, upload-time = "2026-01-21T16:27:18.712Z" }, + { url = "https://files.pythonhosted.org/packages/08/e6/0927784e6ffc340b6676befde1c60260bd51641c9c574b9298d791a9cda4/torchvision-0.25.0-cp314-cp314t-manylinux_2_28_x86_64.whl", hash = "sha256:846890161b825b38aa85fc37fb3ba5eea74e7091ff28bab378287111483b6443", size = 8089772, upload-time = "2026-01-21T16:27:14.048Z" }, + { url = "https://files.pythonhosted.org/packages/b6/37/e7ca4ec820d434c0f23f824eb29f0676a0c3e7a118f1514f5b949c3356da/torchvision-0.25.0-cp314-cp314t-win_amd64.whl", hash = "sha256:f07f01d27375ad89d72aa2b3f2180f07da95dd9d2e4c758e015c0acb2da72977", size = 4425879, upload-time = "2026-01-21T16:27:12.579Z" }, +] + +[[package]] +name = "tornado" +version = "6.5.4" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/37/1d/0a336abf618272d53f62ebe274f712e213f5a03c0b2339575430b8362ef2/tornado-6.5.4.tar.gz", hash = "sha256:a22fa9047405d03260b483980635f0b041989d8bcc9a313f8fe18b411d84b1d7", size = 513632, upload-time = "2025-12-15T19:21:03.836Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/ab/a9/e94a9d5224107d7ce3cc1fab8d5dc97f5ea351ccc6322ee4fb661da94e35/tornado-6.5.4-cp39-abi3-macosx_10_9_universal2.whl", hash = "sha256:d6241c1a16b1c9e4cc28148b1cda97dd1c6cb4fb7068ac1bedc610768dff0ba9", size = 443909, upload-time = "2025-12-15T19:20:48.382Z" }, + { url = "https://files.pythonhosted.org/packages/db/7e/f7b8d8c4453f305a51f80dbb49014257bb7d28ccb4bbb8dd328ea995ecad/tornado-6.5.4-cp39-abi3-macosx_10_9_x86_64.whl", hash = "sha256:2d50f63dda1d2cac3ae1fa23d254e16b5e38153758470e9956cbc3d813d40843", size = 442163, upload-time = "2025-12-15T19:20:49.791Z" }, + { url = "https://files.pythonhosted.org/packages/ba/b5/206f82d51e1bfa940ba366a8d2f83904b15942c45a78dd978b599870ab44/tornado-6.5.4-cp39-abi3-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:d1cf66105dc6acb5af613c054955b8137e34a03698aa53272dbda4afe252be17", size = 445746, upload-time = "2025-12-15T19:20:51.491Z" }, + { url = "https://files.pythonhosted.org/packages/8e/9d/1a3338e0bd30ada6ad4356c13a0a6c35fbc859063fa7eddb309183364ac1/tornado-6.5.4-cp39-abi3-manylinux_2_5_i686.manylinux1_i686.manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:50ff0a58b0dc97939d29da29cd624da010e7f804746621c78d14b80238669335", size = 445083, upload-time = "2025-12-15T19:20:52.778Z" }, + { url = "https://files.pythonhosted.org/packages/50/d4/e51d52047e7eb9a582da59f32125d17c0482d065afd5d3bc435ff2120dc5/tornado-6.5.4-cp39-abi3-manylinux_2_5_x86_64.manylinux1_x86_64.manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:e5fb5e04efa54cf0baabdd10061eb4148e0be137166146fff835745f59ab9f7f", size = 445315, upload-time = "2025-12-15T19:20:53.996Z" }, + { url = "https://files.pythonhosted.org/packages/27/07/2273972f69ca63dbc139694a3fc4684edec3ea3f9efabf77ed32483b875c/tornado-6.5.4-cp39-abi3-musllinux_1_2_aarch64.whl", hash = "sha256:9c86b1643b33a4cd415f8d0fe53045f913bf07b4a3ef646b735a6a86047dda84", size = 446003, upload-time = "2025-12-15T19:20:56.101Z" }, + { url = "https://files.pythonhosted.org/packages/d1/83/41c52e47502bf7260044413b6770d1a48dda2f0246f95ee1384a3cd9c44a/tornado-6.5.4-cp39-abi3-musllinux_1_2_i686.whl", hash = "sha256:6eb82872335a53dd063a4f10917b3efd28270b56a33db69009606a0312660a6f", size = 445412, upload-time = "2025-12-15T19:20:57.398Z" }, + { url = "https://files.pythonhosted.org/packages/10/c7/bc96917f06cbee182d44735d4ecde9c432e25b84f4c2086143013e7b9e52/tornado-6.5.4-cp39-abi3-musllinux_1_2_x86_64.whl", hash = "sha256:6076d5dda368c9328ff41ab5d9dd3608e695e8225d1cd0fd1e006f05da3635a8", size = 445392, upload-time = "2025-12-15T19:20:58.692Z" }, + { url = "https://files.pythonhosted.org/packages/0c/1a/d7592328d037d36f2d2462f4bc1fbb383eec9278bc786c1b111cbbd44cfa/tornado-6.5.4-cp39-abi3-win32.whl", hash = "sha256:1768110f2411d5cd281bac0a090f707223ce77fd110424361092859e089b38d1", size = 446481, upload-time = "2025-12-15T19:21:00.008Z" }, + { url = "https://files.pythonhosted.org/packages/d6/6d/c69be695a0a64fd37a97db12355a035a6d90f79067a3cf936ec2b1dc38cd/tornado-6.5.4-cp39-abi3-win_amd64.whl", hash = "sha256:fa07d31e0cd85c60713f2b995da613588aa03e1303d75705dca6af8babc18ddc", size = 446886, upload-time = "2025-12-15T19:21:01.287Z" }, + { url = "https://files.pythonhosted.org/packages/50/49/8dc3fd90902f70084bd2cd059d576ddb4f8bb44c2c7c0e33a11422acb17e/tornado-6.5.4-cp39-abi3-win_arm64.whl", hash = "sha256:053e6e16701eb6cbe641f308f4c1a9541f91b6261991160391bfc342e8a551a1", size = 445910, upload-time = "2025-12-15T19:21:02.571Z" }, +] + +[[package]] +name = "traitlets" +version = "5.14.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/eb/79/72064e6a701c2183016abbbfedaba506d81e30e232a68c9f0d6f6fcd1574/traitlets-5.14.3.tar.gz", hash = "sha256:9ed0579d3502c94b4b3732ac120375cda96f923114522847de4b3bb98b96b6b7", size = 161621, upload-time = "2024-04-19T11:11:49.746Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/00/c0/8f5d070730d7836adc9c9b6408dec68c6ced86b304a9b26a14df072a6e8c/traitlets-5.14.3-py3-none-any.whl", hash = "sha256:b74e89e397b1ed28cc831db7aea759ba6640cb3de13090ca145426688ff1ac4f", size = 85359, upload-time = "2024-04-19T11:11:46.763Z" }, +] + +[[package]] +name = "triton" +version = "3.6.0" +source = { registry = "https://pypi.org/simple" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/e0/12/b05ba554d2c623bffa59922b94b0775673de251f468a9609bc9e45de95e9/triton-3.6.0-cp311-cp311-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:e8e323d608e3a9bfcc2d9efcc90ceefb764a82b99dea12a86d643c72539ad5d3", size = 188214640, upload-time = "2026-01-20T16:00:35.869Z" }, + { url = "https://files.pythonhosted.org/packages/ab/a8/cdf8b3e4c98132f965f88c2313a4b493266832ad47fb52f23d14d4f86bb5/triton-3.6.0-cp312-cp312-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:74caf5e34b66d9f3a429af689c1c7128daba1d8208df60e81106b115c00d6fca", size = 188266850, upload-time = "2026-01-20T16:00:43.041Z" }, + { url = "https://files.pythonhosted.org/packages/f9/0b/37d991d8c130ce81a8728ae3c25b6e60935838e9be1b58791f5997b24a54/triton-3.6.0-cp313-cp313-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:10c7f76c6e72d2ef08df639e3d0d30729112f47a56b0c81672edc05ee5116ac9", size = 188289450, upload-time = "2026-01-20T16:00:49.136Z" }, + { url = "https://files.pythonhosted.org/packages/35/f8/9c66bfc55361ec6d0e4040a0337fb5924ceb23de4648b8a81ae9d33b2b38/triton-3.6.0-cp313-cp313t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:d002e07d7180fd65e622134fbd980c9a3d4211fb85224b56a0a0efbd422ab72f", size = 188400296, upload-time = "2026-01-20T16:00:56.042Z" }, + { url = "https://files.pythonhosted.org/packages/df/3d/9e7eee57b37c80cec63322c0231bb6da3cfe535a91d7a4d64896fcb89357/triton-3.6.0-cp314-cp314-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:a17a5d5985f0ac494ed8a8e54568f092f7057ef60e1b0fa09d3fd1512064e803", size = 188273063, upload-time = "2026-01-20T16:01:07.278Z" }, + { url = "https://files.pythonhosted.org/packages/f6/56/6113c23ff46c00aae423333eb58b3e60bdfe9179d542781955a5e1514cb3/triton-3.6.0-cp314-cp314t-manylinux_2_27_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:46bd1c1af4b6704e554cad2eeb3b0a6513a980d470ccfa63189737340c7746a7", size = 188397994, upload-time = "2026-01-20T16:01:14.236Z" }, +] + +[[package]] +name = "typing-extensions" +version = "4.15.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/72/94/1a15dd82efb362ac84269196e94cf00f187f7ed21c242792a923cdb1c61f/typing_extensions-4.15.0.tar.gz", hash = "sha256:0cea48d173cc12fa28ecabc3b837ea3cf6f38c6d1136f85cbaaf598984861466", size = 109391, upload-time = "2025-08-25T13:49:26.313Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/18/67/36e9267722cc04a6b9f15c7f3441c2363321a3ea07da7ae0c0707beb2a9c/typing_extensions-4.15.0-py3-none-any.whl", hash = "sha256:f0fa19c6845758ab08074a0cfa8b7aecb71c999ca73d62883bc25cc018c4e548", size = 44614, upload-time = "2025-08-25T13:49:24.86Z" }, +] + +[[package]] +name = "typing-inspection" +version = "0.4.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "typing-extensions" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/55/e3/70399cb7dd41c10ac53367ae42139cf4b1ca5f36bb3dc6c9d33acdb43655/typing_inspection-0.4.2.tar.gz", hash = "sha256:ba561c48a67c5958007083d386c3295464928b01faa735ab8547c5692e87f464", size = 75949, upload-time = "2025-10-01T02:14:41.687Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/dc/9b/47798a6c91d8bdb567fe2698fe81e0c6b7cb7ef4d13da4114b41d239f65d/typing_inspection-0.4.2-py3-none-any.whl", hash = "sha256:4ed1cacbdc298c220f1bd249ed5287caa16f34d44ef4e9c3d0cbad5b521545e7", size = 14611, upload-time = "2025-10-01T02:14:40.154Z" }, +] + +[[package]] +name = "tzdata" +version = "2025.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/5e/a7/c202b344c5ca7daf398f3b8a477eeb205cf3b6f32e7ec3a6bac0629ca975/tzdata-2025.3.tar.gz", hash = "sha256:de39c2ca5dc7b0344f2eba86f49d614019d29f060fc4ebc8a417896a620b56a7", size = 196772, upload-time = "2025-12-13T17:45:35.667Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c7/b0/003792df09decd6849a5e39c28b513c06e84436a54440380862b5aeff25d/tzdata-2025.3-py2.py3-none-any.whl", hash = "sha256:06a47e5700f3081aab02b2e513160914ff0694bce9947d6b76ebd6bf57cfc5d1", size = 348521, upload-time = "2025-12-13T17:45:33.889Z" }, +] + +[[package]] +name = "urllib3" +version = "2.6.3" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/c7/24/5f1b3bdffd70275f6661c76461e25f024d5a38a46f04aaca912426a2b1d3/urllib3-2.6.3.tar.gz", hash = "sha256:1b62b6884944a57dbe321509ab94fd4d3b307075e0c2eae991ac71ee15ad38ed", size = 435556, upload-time = "2026-01-07T16:24:43.925Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/39/08/aaaad47bc4e9dc8c725e68f9d04865dbcb2052843ff09c97b08904852d84/urllib3-2.6.3-py3-none-any.whl", hash = "sha256:bf272323e553dfb2e87d9bfd225ca7b0f467b919d7bbd355436d3fd37cb0acd4", size = 131584, upload-time = "2026-01-07T16:24:42.685Z" }, +] + +[[package]] +name = "uvicorn" +version = "0.41.0" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "click" }, + { name = "h11" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/32/ce/eeb58ae4ac36fe09e3842eb02e0eb676bf2c53ae062b98f1b2531673efdd/uvicorn-0.41.0.tar.gz", hash = "sha256:09d11cf7008da33113824ee5a1c6422d89fbc2ff476540d69a34c87fab8b571a", size = 82633, upload-time = "2026-02-16T23:07:24.1Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/83/e4/d04a086285c20886c0daad0e026f250869201013d18f81d9ff5eada73a88/uvicorn-0.41.0-py3-none-any.whl", hash = "sha256:29e35b1d2c36a04b9e180d4007ede3bcb32a85fbdfd6c6aeb3f26839de088187", size = 68783, upload-time = "2026-02-16T23:07:22.357Z" }, +] + +[package.optional-dependencies] +standard = [ + { name = "colorama", marker = "sys_platform == 'win32'" }, + { name = "httptools" }, + { name = "python-dotenv" }, + { name = "pyyaml" }, + { name = "uvloop", marker = "platform_python_implementation != 'PyPy' and sys_platform != 'cygwin' and sys_platform != 'win32'" }, + { name = "watchfiles" }, + { name = "websockets" }, +] + +[[package]] +name = "uvloop" +version = "0.22.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/06/f0/18d39dbd1971d6d62c4629cc7fa67f74821b0dc1f5a77af43719de7936a7/uvloop-0.22.1.tar.gz", hash = "sha256:6c84bae345b9147082b17371e3dd5d42775bddce91f885499017f4607fdaf39f", size = 2443250, upload-time = "2025-10-16T22:17:19.342Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c7/d5/69900f7883235562f1f50d8184bb7dd84a2fb61e9ec63f3782546fdbd057/uvloop-0.22.1-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:c60ebcd36f7b240b30788554b6f0782454826a0ed765d8430652621b5de674b9", size = 1352420, upload-time = "2025-10-16T22:16:21.187Z" }, + { url = "https://files.pythonhosted.org/packages/a8/73/c4e271b3bce59724e291465cc936c37758886a4868787da0278b3b56b905/uvloop-0.22.1-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:3b7f102bf3cb1995cfeaee9321105e8f5da76fdb104cdad8986f85461a1b7b77", size = 748677, upload-time = "2025-10-16T22:16:22.558Z" }, + { url = "https://files.pythonhosted.org/packages/86/94/9fb7fad2f824d25f8ecac0d70b94d0d48107ad5ece03769a9c543444f78a/uvloop-0.22.1-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:53c85520781d84a4b8b230e24a5af5b0778efdb39142b424990ff1ef7c48ba21", size = 3753819, upload-time = "2025-10-16T22:16:23.903Z" }, + { url = "https://files.pythonhosted.org/packages/74/4f/256aca690709e9b008b7108bc85fba619a2bc37c6d80743d18abad16ee09/uvloop-0.22.1-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:56a2d1fae65fd82197cb8c53c367310b3eabe1bbb9fb5a04d28e3e3520e4f702", size = 3804529, upload-time = "2025-10-16T22:16:25.246Z" }, + { url = "https://files.pythonhosted.org/packages/7f/74/03c05ae4737e871923d21a76fe28b6aad57f5c03b6e6bfcfa5ad616013e4/uvloop-0.22.1-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:40631b049d5972c6755b06d0bfe8233b1bd9a8a6392d9d1c45c10b6f9e9b2733", size = 3621267, upload-time = "2025-10-16T22:16:26.819Z" }, + { url = "https://files.pythonhosted.org/packages/75/be/f8e590fe61d18b4a92070905497aec4c0e64ae1761498cad09023f3f4b3e/uvloop-0.22.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:535cc37b3a04f6cd2c1ef65fa1d370c9a35b6695df735fcff5427323f2cd5473", size = 3723105, upload-time = "2025-10-16T22:16:28.252Z" }, + { url = "https://files.pythonhosted.org/packages/3d/ff/7f72e8170be527b4977b033239a83a68d5c881cc4775fca255c677f7ac5d/uvloop-0.22.1-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:fe94b4564e865d968414598eea1a6de60adba0c040ba4ed05ac1300de402cd42", size = 1359936, upload-time = "2025-10-16T22:16:29.436Z" }, + { url = "https://files.pythonhosted.org/packages/c3/c6/e5d433f88fd54d81ef4be58b2b7b0cea13c442454a1db703a1eea0db1a59/uvloop-0.22.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:51eb9bd88391483410daad430813d982010f9c9c89512321f5b60e2cddbdddd6", size = 752769, upload-time = "2025-10-16T22:16:30.493Z" }, + { url = "https://files.pythonhosted.org/packages/24/68/a6ac446820273e71aa762fa21cdcc09861edd3536ff47c5cd3b7afb10eeb/uvloop-0.22.1-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:700e674a166ca5778255e0e1dc4e9d79ab2acc57b9171b79e65feba7184b3370", size = 4317413, upload-time = "2025-10-16T22:16:31.644Z" }, + { url = "https://files.pythonhosted.org/packages/5f/6f/e62b4dfc7ad6518e7eff2516f680d02a0f6eb62c0c212e152ca708a0085e/uvloop-0.22.1-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:7b5b1ac819a3f946d3b2ee07f09149578ae76066d70b44df3fa990add49a82e4", size = 4426307, upload-time = "2025-10-16T22:16:32.917Z" }, + { url = "https://files.pythonhosted.org/packages/90/60/97362554ac21e20e81bcef1150cb2a7e4ffdaf8ea1e5b2e8bf7a053caa18/uvloop-0.22.1-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:e047cc068570bac9866237739607d1313b9253c3051ad84738cbb095be0537b2", size = 4131970, upload-time = "2025-10-16T22:16:34.015Z" }, + { url = "https://files.pythonhosted.org/packages/99/39/6b3f7d234ba3964c428a6e40006340f53ba37993f46ed6e111c6e9141d18/uvloop-0.22.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:512fec6815e2dd45161054592441ef76c830eddaad55c8aa30952e6fe1ed07c0", size = 4296343, upload-time = "2025-10-16T22:16:35.149Z" }, + { url = "https://files.pythonhosted.org/packages/89/8c/182a2a593195bfd39842ea68ebc084e20c850806117213f5a299dfc513d9/uvloop-0.22.1-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:561577354eb94200d75aca23fbde86ee11be36b00e52a4eaf8f50fb0c86b7705", size = 1358611, upload-time = "2025-10-16T22:16:36.833Z" }, + { url = "https://files.pythonhosted.org/packages/d2/14/e301ee96a6dc95224b6f1162cd3312f6d1217be3907b79173b06785f2fe7/uvloop-0.22.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:1cdf5192ab3e674ca26da2eada35b288d2fa49fdd0f357a19f0e7c4e7d5077c8", size = 751811, upload-time = "2025-10-16T22:16:38.275Z" }, + { url = "https://files.pythonhosted.org/packages/b7/02/654426ce265ac19e2980bfd9ea6590ca96a56f10c76e63801a2df01c0486/uvloop-0.22.1-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:6e2ea3d6190a2968f4a14a23019d3b16870dd2190cd69c8180f7c632d21de68d", size = 4288562, upload-time = "2025-10-16T22:16:39.375Z" }, + { url = "https://files.pythonhosted.org/packages/15/c0/0be24758891ef825f2065cd5db8741aaddabe3e248ee6acc5e8a80f04005/uvloop-0.22.1-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:0530a5fbad9c9e4ee3f2b33b148c6a64d47bbad8000ea63704fa8260f4cf728e", size = 4366890, upload-time = "2025-10-16T22:16:40.547Z" }, + { url = "https://files.pythonhosted.org/packages/d2/53/8369e5219a5855869bcee5f4d317f6da0e2c669aecf0ef7d371e3d084449/uvloop-0.22.1-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:bc5ef13bbc10b5335792360623cc378d52d7e62c2de64660616478c32cd0598e", size = 4119472, upload-time = "2025-10-16T22:16:41.694Z" }, + { url = "https://files.pythonhosted.org/packages/f8/ba/d69adbe699b768f6b29a5eec7b47dd610bd17a69de51b251126a801369ea/uvloop-0.22.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:1f38ec5e3f18c8a10ded09742f7fb8de0108796eb673f30ce7762ce1b8550cad", size = 4239051, upload-time = "2025-10-16T22:16:43.224Z" }, + { url = "https://files.pythonhosted.org/packages/90/cd/b62bdeaa429758aee8de8b00ac0dd26593a9de93d302bff3d21439e9791d/uvloop-0.22.1-cp314-cp314-macosx_10_13_universal2.whl", hash = "sha256:3879b88423ec7e97cd4eba2a443aa26ed4e59b45e6b76aabf13fe2f27023a142", size = 1362067, upload-time = "2025-10-16T22:16:44.503Z" }, + { url = "https://files.pythonhosted.org/packages/0d/f8/a132124dfda0777e489ca86732e85e69afcd1ff7686647000050ba670689/uvloop-0.22.1-cp314-cp314-macosx_10_13_x86_64.whl", hash = "sha256:4baa86acedf1d62115c1dc6ad1e17134476688f08c6efd8a2ab076e815665c74", size = 752423, upload-time = "2025-10-16T22:16:45.968Z" }, + { url = "https://files.pythonhosted.org/packages/a3/94/94af78c156f88da4b3a733773ad5ba0b164393e357cc4bd0ab2e2677a7d6/uvloop-0.22.1-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:297c27d8003520596236bdb2335e6b3f649480bd09e00d1e3a99144b691d2a35", size = 4272437, upload-time = "2025-10-16T22:16:47.451Z" }, + { url = "https://files.pythonhosted.org/packages/b5/35/60249e9fd07b32c665192cec7af29e06c7cd96fa1d08b84f012a56a0b38e/uvloop-0.22.1-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:c1955d5a1dd43198244d47664a5858082a3239766a839b2102a269aaff7a4e25", size = 4292101, upload-time = "2025-10-16T22:16:49.318Z" }, + { url = "https://files.pythonhosted.org/packages/02/62/67d382dfcb25d0a98ce73c11ed1a6fba5037a1a1d533dcbb7cab033a2636/uvloop-0.22.1-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:b31dc2fccbd42adc73bc4e7cdbae4fc5086cf378979e53ca5d0301838c5682c6", size = 4114158, upload-time = "2025-10-16T22:16:50.517Z" }, + { url = "https://files.pythonhosted.org/packages/f0/7a/f1171b4a882a5d13c8b7576f348acfe6074d72eaf52cccef752f748d4a9f/uvloop-0.22.1-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:93f617675b2d03af4e72a5333ef89450dfaa5321303ede6e67ba9c9d26878079", size = 4177360, upload-time = "2025-10-16T22:16:52.646Z" }, + { url = "https://files.pythonhosted.org/packages/79/7b/b01414f31546caf0919da80ad57cbfe24c56b151d12af68cee1b04922ca8/uvloop-0.22.1-cp314-cp314t-macosx_10_13_universal2.whl", hash = "sha256:37554f70528f60cad66945b885eb01f1bb514f132d92b6eeed1c90fd54ed6289", size = 1454790, upload-time = "2025-10-16T22:16:54.355Z" }, + { url = "https://files.pythonhosted.org/packages/d4/31/0bb232318dd838cad3fa8fb0c68c8b40e1145b32025581975e18b11fab40/uvloop-0.22.1-cp314-cp314t-macosx_10_13_x86_64.whl", hash = "sha256:b76324e2dc033a0b2f435f33eb88ff9913c156ef78e153fb210e03c13da746b3", size = 796783, upload-time = "2025-10-16T22:16:55.906Z" }, + { url = "https://files.pythonhosted.org/packages/42/38/c9b09f3271a7a723a5de69f8e237ab8e7803183131bc57c890db0b6bb872/uvloop-0.22.1-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:badb4d8e58ee08dad957002027830d5c3b06aea446a6a3744483c2b3b745345c", size = 4647548, upload-time = "2025-10-16T22:16:57.008Z" }, + { url = "https://files.pythonhosted.org/packages/c1/37/945b4ca0ac27e3dc4952642d4c900edd030b3da6c9634875af6e13ae80e5/uvloop-0.22.1-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:b91328c72635f6f9e0282e4a57da7470c7350ab1c9f48546c0f2866205349d21", size = 4467065, upload-time = "2025-10-16T22:16:58.206Z" }, + { url = "https://files.pythonhosted.org/packages/97/cc/48d232f33d60e2e2e0b42f4e73455b146b76ebe216487e862700457fbf3c/uvloop-0.22.1-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:daf620c2995d193449393d6c62131b3fbd40a63bf7b307a1527856ace637fe88", size = 4328384, upload-time = "2025-10-16T22:16:59.36Z" }, + { url = "https://files.pythonhosted.org/packages/e4/16/c1fd27e9549f3c4baf1dc9c20c456cd2f822dbf8de9f463824b0c0357e06/uvloop-0.22.1-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:6cde23eeda1a25c75b2e07d39970f3374105d5eafbaab2a4482be82f272d5a5e", size = 4296730, upload-time = "2025-10-16T22:17:00.744Z" }, +] + +[[package]] +name = "watchfiles" +version = "1.1.1" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "anyio" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/c2/c9/8869df9b2a2d6c59d79220a4db37679e74f807c559ffe5265e08b227a210/watchfiles-1.1.1.tar.gz", hash = "sha256:a173cb5c16c4f40ab19cecf48a534c409f7ea983ab8fed0741304a1c0a31b3f2", size = 94440, upload-time = "2025-10-14T15:06:21.08Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/1f/f8/2c5f479fb531ce2f0564eda479faecf253d886b1ab3630a39b7bf7362d46/watchfiles-1.1.1-cp311-cp311-macosx_10_12_x86_64.whl", hash = "sha256:f57b396167a2565a4e8b5e56a5a1c537571733992b226f4f1197d79e94cf0ae5", size = 406529, upload-time = "2025-10-14T15:04:32.899Z" }, + { url = "https://files.pythonhosted.org/packages/fe/cd/f515660b1f32f65df671ddf6f85bfaca621aee177712874dc30a97397977/watchfiles-1.1.1-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:421e29339983e1bebc281fab40d812742268ad057db4aee8c4d2bce0af43b741", size = 394384, upload-time = "2025-10-14T15:04:33.761Z" }, + { url = "https://files.pythonhosted.org/packages/7b/c3/28b7dc99733eab43fca2d10f55c86e03bd6ab11ca31b802abac26b23d161/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:6e43d39a741e972bab5d8100b5cdacf69db64e34eb19b6e9af162bccf63c5cc6", size = 448789, upload-time = "2025-10-14T15:04:34.679Z" }, + { url = "https://files.pythonhosted.org/packages/4a/24/33e71113b320030011c8e4316ccca04194bf0cbbaeee207f00cbc7d6b9f5/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:f537afb3276d12814082a2e9b242bdcf416c2e8fd9f799a737990a1dbe906e5b", size = 460521, upload-time = "2025-10-14T15:04:35.963Z" }, + { url = "https://files.pythonhosted.org/packages/f4/c3/3c9a55f255aa57b91579ae9e98c88704955fa9dac3e5614fb378291155df/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:b2cd9e04277e756a2e2d2543d65d1e2166d6fd4c9b183f8808634fda23f17b14", size = 488722, upload-time = "2025-10-14T15:04:37.091Z" }, + { url = "https://files.pythonhosted.org/packages/49/36/506447b73eb46c120169dc1717fe2eff07c234bb3232a7200b5f5bd816e9/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:5f3f58818dc0b07f7d9aa7fe9eb1037aecb9700e63e1f6acfed13e9fef648f5d", size = 596088, upload-time = "2025-10-14T15:04:38.39Z" }, + { url = "https://files.pythonhosted.org/packages/82/ab/5f39e752a9838ec4d52e9b87c1e80f1ee3ccdbe92e183c15b6577ab9de16/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:9bb9f66367023ae783551042d31b1d7fd422e8289eedd91f26754a66f44d5cff", size = 472923, upload-time = "2025-10-14T15:04:39.666Z" }, + { url = "https://files.pythonhosted.org/packages/af/b9/a419292f05e302dea372fa7e6fda5178a92998411f8581b9830d28fb9edb/watchfiles-1.1.1-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:aebfd0861a83e6c3d1110b78ad54704486555246e542be3e2bb94195eabb2606", size = 456080, upload-time = "2025-10-14T15:04:40.643Z" }, + { url = "https://files.pythonhosted.org/packages/b0/c3/d5932fd62bde1a30c36e10c409dc5d54506726f08cb3e1d8d0ba5e2bc8db/watchfiles-1.1.1-cp311-cp311-musllinux_1_1_aarch64.whl", hash = "sha256:5fac835b4ab3c6487b5dbad78c4b3724e26bcc468e886f8ba8cc4306f68f6701", size = 629432, upload-time = "2025-10-14T15:04:41.789Z" }, + { url = "https://files.pythonhosted.org/packages/f7/77/16bddd9779fafb795f1a94319dc965209c5641db5bf1edbbccace6d1b3c0/watchfiles-1.1.1-cp311-cp311-musllinux_1_1_x86_64.whl", hash = "sha256:399600947b170270e80134ac854e21b3ccdefa11a9529a3decc1327088180f10", size = 623046, upload-time = "2025-10-14T15:04:42.718Z" }, + { url = "https://files.pythonhosted.org/packages/46/ef/f2ecb9a0f342b4bfad13a2787155c6ee7ce792140eac63a34676a2feeef2/watchfiles-1.1.1-cp311-cp311-win32.whl", hash = "sha256:de6da501c883f58ad50db3a32ad397b09ad29865b5f26f64c24d3e3281685849", size = 271473, upload-time = "2025-10-14T15:04:43.624Z" }, + { url = "https://files.pythonhosted.org/packages/94/bc/f42d71125f19731ea435c3948cad148d31a64fccde3867e5ba4edee901f9/watchfiles-1.1.1-cp311-cp311-win_amd64.whl", hash = "sha256:35c53bd62a0b885bf653ebf6b700d1bf05debb78ad9292cf2a942b23513dc4c4", size = 287598, upload-time = "2025-10-14T15:04:44.516Z" }, + { url = "https://files.pythonhosted.org/packages/57/c9/a30f897351f95bbbfb6abcadafbaca711ce1162f4db95fc908c98a9165f3/watchfiles-1.1.1-cp311-cp311-win_arm64.whl", hash = "sha256:57ca5281a8b5e27593cb7d82c2ac927ad88a96ed406aa446f6344e4328208e9e", size = 277210, upload-time = "2025-10-14T15:04:45.883Z" }, + { url = "https://files.pythonhosted.org/packages/74/d5/f039e7e3c639d9b1d09b07ea412a6806d38123f0508e5f9b48a87b0a76cc/watchfiles-1.1.1-cp312-cp312-macosx_10_12_x86_64.whl", hash = "sha256:8c89f9f2f740a6b7dcc753140dd5e1ab9215966f7a3530d0c0705c83b401bd7d", size = 404745, upload-time = "2025-10-14T15:04:46.731Z" }, + { url = "https://files.pythonhosted.org/packages/a5/96/a881a13aa1349827490dab2d363c8039527060cfcc2c92cc6d13d1b1049e/watchfiles-1.1.1-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:bd404be08018c37350f0d6e34676bd1e2889990117a2b90070b3007f172d0610", size = 391769, upload-time = "2025-10-14T15:04:48.003Z" }, + { url = "https://files.pythonhosted.org/packages/4b/5b/d3b460364aeb8da471c1989238ea0e56bec24b6042a68046adf3d9ddb01c/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:8526e8f916bb5b9a0a777c8317c23ce65de259422bba5b31325a6fa6029d33af", size = 449374, upload-time = "2025-10-14T15:04:49.179Z" }, + { url = "https://files.pythonhosted.org/packages/b9/44/5769cb62d4ed055cb17417c0a109a92f007114a4e07f30812a73a4efdb11/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:2edc3553362b1c38d9f06242416a5d8e9fe235c204a4072e988ce2e5bb1f69f6", size = 459485, upload-time = "2025-10-14T15:04:50.155Z" }, + { url = "https://files.pythonhosted.org/packages/19/0c/286b6301ded2eccd4ffd0041a1b726afda999926cf720aab63adb68a1e36/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:30f7da3fb3f2844259cba4720c3fc7138eb0f7b659c38f3bfa65084c7fc7abce", size = 488813, upload-time = "2025-10-14T15:04:51.059Z" }, + { url = "https://files.pythonhosted.org/packages/c7/2b/8530ed41112dd4a22f4dcfdb5ccf6a1baad1ff6eed8dc5a5f09e7e8c41c7/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:f8979280bdafff686ba5e4d8f97840f929a87ed9cdf133cbbd42f7766774d2aa", size = 594816, upload-time = "2025-10-14T15:04:52.031Z" }, + { url = "https://files.pythonhosted.org/packages/ce/d2/f5f9fb49489f184f18470d4f99f4e862a4b3e9ac2865688eb2099e3d837a/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:dcc5c24523771db3a294c77d94771abcfcb82a0e0ee8efd910c37c59ec1b31bb", size = 475186, upload-time = "2025-10-14T15:04:53.064Z" }, + { url = "https://files.pythonhosted.org/packages/cf/68/5707da262a119fb06fbe214d82dd1fe4a6f4af32d2d14de368d0349eb52a/watchfiles-1.1.1-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:1db5d7ae38ff20153d542460752ff397fcf5c96090c1230803713cf3147a6803", size = 456812, upload-time = "2025-10-14T15:04:55.174Z" }, + { url = "https://files.pythonhosted.org/packages/66/ab/3cbb8756323e8f9b6f9acb9ef4ec26d42b2109bce830cc1f3468df20511d/watchfiles-1.1.1-cp312-cp312-musllinux_1_1_aarch64.whl", hash = "sha256:28475ddbde92df1874b6c5c8aaeb24ad5be47a11f87cde5a28ef3835932e3e94", size = 630196, upload-time = "2025-10-14T15:04:56.22Z" }, + { url = "https://files.pythonhosted.org/packages/78/46/7152ec29b8335f80167928944a94955015a345440f524d2dfe63fc2f437b/watchfiles-1.1.1-cp312-cp312-musllinux_1_1_x86_64.whl", hash = "sha256:36193ed342f5b9842edd3532729a2ad55c4160ffcfa3700e0d54be496b70dd43", size = 622657, upload-time = "2025-10-14T15:04:57.521Z" }, + { url = "https://files.pythonhosted.org/packages/0a/bf/95895e78dd75efe9a7f31733607f384b42eb5feb54bd2eb6ed57cc2e94f4/watchfiles-1.1.1-cp312-cp312-win32.whl", hash = "sha256:859e43a1951717cc8de7f4c77674a6d389b106361585951d9e69572823f311d9", size = 272042, upload-time = "2025-10-14T15:04:59.046Z" }, + { url = "https://files.pythonhosted.org/packages/87/0a/90eb755f568de2688cb220171c4191df932232c20946966c27a59c400850/watchfiles-1.1.1-cp312-cp312-win_amd64.whl", hash = "sha256:91d4c9a823a8c987cce8fa2690923b069966dabb196dd8d137ea2cede885fde9", size = 288410, upload-time = "2025-10-14T15:05:00.081Z" }, + { url = "https://files.pythonhosted.org/packages/36/76/f322701530586922fbd6723c4f91ace21364924822a8772c549483abed13/watchfiles-1.1.1-cp312-cp312-win_arm64.whl", hash = "sha256:a625815d4a2bdca61953dbba5a39d60164451ef34c88d751f6c368c3ea73d404", size = 278209, upload-time = "2025-10-14T15:05:01.168Z" }, + { url = "https://files.pythonhosted.org/packages/bb/f4/f750b29225fe77139f7ae5de89d4949f5a99f934c65a1f1c0b248f26f747/watchfiles-1.1.1-cp313-cp313-macosx_10_12_x86_64.whl", hash = "sha256:130e4876309e8686a5e37dba7d5e9bc77e6ed908266996ca26572437a5271e18", size = 404321, upload-time = "2025-10-14T15:05:02.063Z" }, + { url = "https://files.pythonhosted.org/packages/2b/f9/f07a295cde762644aa4c4bb0f88921d2d141af45e735b965fb2e87858328/watchfiles-1.1.1-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:5f3bde70f157f84ece3765b42b4a52c6ac1a50334903c6eaf765362f6ccca88a", size = 391783, upload-time = "2025-10-14T15:05:03.052Z" }, + { url = "https://files.pythonhosted.org/packages/bc/11/fc2502457e0bea39a5c958d86d2cb69e407a4d00b85735ca724bfa6e0d1a/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:14e0b1fe858430fc0251737ef3824c54027bedb8c37c38114488b8e131cf8219", size = 449279, upload-time = "2025-10-14T15:05:04.004Z" }, + { url = "https://files.pythonhosted.org/packages/e3/1f/d66bc15ea0b728df3ed96a539c777acfcad0eb78555ad9efcaa1274688f0/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:f27db948078f3823a6bb3b465180db8ebecf26dd5dae6f6180bd87383b6b4428", size = 459405, upload-time = "2025-10-14T15:05:04.942Z" }, + { url = "https://files.pythonhosted.org/packages/be/90/9f4a65c0aec3ccf032703e6db02d89a157462fbb2cf20dd415128251cac0/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:059098c3a429f62fc98e8ec62b982230ef2c8df68c79e826e37b895bc359a9c0", size = 488976, upload-time = "2025-10-14T15:05:05.905Z" }, + { url = "https://files.pythonhosted.org/packages/37/57/ee347af605d867f712be7029bb94c8c071732a4b44792e3176fa3c612d39/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:bfb5862016acc9b869bb57284e6cb35fdf8e22fe59f7548858e2f971d045f150", size = 595506, upload-time = "2025-10-14T15:05:06.906Z" }, + { url = "https://files.pythonhosted.org/packages/a8/78/cc5ab0b86c122047f75e8fc471c67a04dee395daf847d3e59381996c8707/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:319b27255aacd9923b8a276bb14d21a5f7ff82564c744235fc5eae58d95422ae", size = 474936, upload-time = "2025-10-14T15:05:07.906Z" }, + { url = "https://files.pythonhosted.org/packages/62/da/def65b170a3815af7bd40a3e7010bf6ab53089ef1b75d05dd5385b87cf08/watchfiles-1.1.1-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:c755367e51db90e75b19454b680903631d41f9e3607fbd941d296a020c2d752d", size = 456147, upload-time = "2025-10-14T15:05:09.138Z" }, + { url = "https://files.pythonhosted.org/packages/57/99/da6573ba71166e82d288d4df0839128004c67d2778d3b566c138695f5c0b/watchfiles-1.1.1-cp313-cp313-musllinux_1_1_aarch64.whl", hash = "sha256:c22c776292a23bfc7237a98f791b9ad3144b02116ff10d820829ce62dff46d0b", size = 630007, upload-time = "2025-10-14T15:05:10.117Z" }, + { url = "https://files.pythonhosted.org/packages/a8/51/7439c4dd39511368849eb1e53279cd3454b4a4dbace80bab88feeb83c6b5/watchfiles-1.1.1-cp313-cp313-musllinux_1_1_x86_64.whl", hash = "sha256:3a476189be23c3686bc2f4321dd501cb329c0a0469e77b7b534ee10129ae6374", size = 622280, upload-time = "2025-10-14T15:05:11.146Z" }, + { url = "https://files.pythonhosted.org/packages/95/9c/8ed97d4bba5db6fdcdb2b298d3898f2dd5c20f6b73aee04eabe56c59677e/watchfiles-1.1.1-cp313-cp313-win32.whl", hash = "sha256:bf0a91bfb5574a2f7fc223cf95eeea79abfefa404bf1ea5e339c0c1560ae99a0", size = 272056, upload-time = "2025-10-14T15:05:12.156Z" }, + { url = "https://files.pythonhosted.org/packages/1f/f3/c14e28429f744a260d8ceae18bf58c1d5fa56b50d006a7a9f80e1882cb0d/watchfiles-1.1.1-cp313-cp313-win_amd64.whl", hash = "sha256:52e06553899e11e8074503c8e716d574adeeb7e68913115c4b3653c53f9bae42", size = 288162, upload-time = "2025-10-14T15:05:13.208Z" }, + { url = "https://files.pythonhosted.org/packages/dc/61/fe0e56c40d5cd29523e398d31153218718c5786b5e636d9ae8ae79453d27/watchfiles-1.1.1-cp313-cp313-win_arm64.whl", hash = "sha256:ac3cc5759570cd02662b15fbcd9d917f7ecd47efe0d6b40474eafd246f91ea18", size = 277909, upload-time = "2025-10-14T15:05:14.49Z" }, + { url = "https://files.pythonhosted.org/packages/79/42/e0a7d749626f1e28c7108a99fb9bf524b501bbbeb9b261ceecde644d5a07/watchfiles-1.1.1-cp313-cp313t-macosx_10_12_x86_64.whl", hash = "sha256:563b116874a9a7ce6f96f87cd0b94f7faf92d08d0021e837796f0a14318ef8da", size = 403389, upload-time = "2025-10-14T15:05:15.777Z" }, + { url = "https://files.pythonhosted.org/packages/15/49/08732f90ce0fbbc13913f9f215c689cfc9ced345fb1bcd8829a50007cc8d/watchfiles-1.1.1-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:3ad9fe1dae4ab4212d8c91e80b832425e24f421703b5a42ef2e4a1e215aff051", size = 389964, upload-time = "2025-10-14T15:05:16.85Z" }, + { url = "https://files.pythonhosted.org/packages/27/0d/7c315d4bd5f2538910491a0393c56bf70d333d51bc5b34bee8e68e8cea19/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:ce70f96a46b894b36eba678f153f052967a0d06d5b5a19b336ab0dbbd029f73e", size = 448114, upload-time = "2025-10-14T15:05:17.876Z" }, + { url = "https://files.pythonhosted.org/packages/c3/24/9e096de47a4d11bc4df41e9d1e61776393eac4cb6eb11b3e23315b78b2cc/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:cb467c999c2eff23a6417e58d75e5828716f42ed8289fe6b77a7e5a91036ca70", size = 460264, upload-time = "2025-10-14T15:05:18.962Z" }, + { url = "https://files.pythonhosted.org/packages/cc/0f/e8dea6375f1d3ba5fcb0b3583e2b493e77379834c74fd5a22d66d85d6540/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:836398932192dae4146c8f6f737d74baeac8b70ce14831a239bdb1ca882fc261", size = 487877, upload-time = "2025-10-14T15:05:20.094Z" }, + { url = "https://files.pythonhosted.org/packages/ac/5b/df24cfc6424a12deb41503b64d42fbea6b8cb357ec62ca84a5a3476f654a/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:743185e7372b7bc7c389e1badcc606931a827112fbbd37f14c537320fca08620", size = 595176, upload-time = "2025-10-14T15:05:21.134Z" }, + { url = "https://files.pythonhosted.org/packages/8f/b5/853b6757f7347de4e9b37e8cc3289283fb983cba1ab4d2d7144694871d9c/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:afaeff7696e0ad9f02cbb8f56365ff4686ab205fcf9c4c5b6fdfaaa16549dd04", size = 473577, upload-time = "2025-10-14T15:05:22.306Z" }, + { url = "https://files.pythonhosted.org/packages/e1/f7/0a4467be0a56e80447c8529c9fce5b38eab4f513cb3d9bf82e7392a5696b/watchfiles-1.1.1-cp313-cp313t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:3f7eb7da0eb23aa2ba036d4f616d46906013a68caf61b7fdbe42fc8b25132e77", size = 455425, upload-time = "2025-10-14T15:05:23.348Z" }, + { url = "https://files.pythonhosted.org/packages/8e/e0/82583485ea00137ddf69bc84a2db88bd92ab4a6e3c405e5fb878ead8d0e7/watchfiles-1.1.1-cp313-cp313t-musllinux_1_1_aarch64.whl", hash = "sha256:831a62658609f0e5c64178211c942ace999517f5770fe9436be4c2faeba0c0ef", size = 628826, upload-time = "2025-10-14T15:05:24.398Z" }, + { url = "https://files.pythonhosted.org/packages/28/9a/a785356fccf9fae84c0cc90570f11702ae9571036fb25932f1242c82191c/watchfiles-1.1.1-cp313-cp313t-musllinux_1_1_x86_64.whl", hash = "sha256:f9a2ae5c91cecc9edd47e041a930490c31c3afb1f5e6d71de3dc671bfaca02bf", size = 622208, upload-time = "2025-10-14T15:05:25.45Z" }, + { url = "https://files.pythonhosted.org/packages/c3/f4/0872229324ef69b2c3edec35e84bd57a1289e7d3fe74588048ed8947a323/watchfiles-1.1.1-cp314-cp314-macosx_10_12_x86_64.whl", hash = "sha256:d1715143123baeeaeadec0528bb7441103979a1d5f6fd0e1f915383fea7ea6d5", size = 404315, upload-time = "2025-10-14T15:05:26.501Z" }, + { url = "https://files.pythonhosted.org/packages/7b/22/16d5331eaed1cb107b873f6ae1b69e9ced582fcf0c59a50cd84f403b1c32/watchfiles-1.1.1-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:39574d6370c4579d7f5d0ad940ce5b20db0e4117444e39b6d8f99db5676c52fd", size = 390869, upload-time = "2025-10-14T15:05:27.649Z" }, + { url = "https://files.pythonhosted.org/packages/b2/7e/5643bfff5acb6539b18483128fdc0ef2cccc94a5b8fbda130c823e8ed636/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:7365b92c2e69ee952902e8f70f3ba6360d0d596d9299d55d7d386df84b6941fb", size = 449919, upload-time = "2025-10-14T15:05:28.701Z" }, + { url = "https://files.pythonhosted.org/packages/51/2e/c410993ba5025a9f9357c376f48976ef0e1b1aefb73b97a5ae01a5972755/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:bfff9740c69c0e4ed32416f013f3c45e2ae42ccedd1167ef2d805c000b6c71a5", size = 460845, upload-time = "2025-10-14T15:05:30.064Z" }, + { url = "https://files.pythonhosted.org/packages/8e/a4/2df3b404469122e8680f0fcd06079317e48db58a2da2950fb45020947734/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:b27cf2eb1dda37b2089e3907d8ea92922b673c0c427886d4edc6b94d8dfe5db3", size = 489027, upload-time = "2025-10-14T15:05:31.064Z" }, + { url = "https://files.pythonhosted.org/packages/ea/84/4587ba5b1f267167ee715b7f66e6382cca6938e0a4b870adad93e44747e6/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:526e86aced14a65a5b0ec50827c745597c782ff46b571dbfe46192ab9e0b3c33", size = 595615, upload-time = "2025-10-14T15:05:32.074Z" }, + { url = "https://files.pythonhosted.org/packages/6a/0f/c6988c91d06e93cd0bb3d4a808bcf32375ca1904609835c3031799e3ecae/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:04e78dd0b6352db95507fd8cb46f39d185cf8c74e4cf1e4fbad1d3df96faf510", size = 474836, upload-time = "2025-10-14T15:05:33.209Z" }, + { url = "https://files.pythonhosted.org/packages/b4/36/ded8aebea91919485b7bbabbd14f5f359326cb5ec218cd67074d1e426d74/watchfiles-1.1.1-cp314-cp314-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:5c85794a4cfa094714fb9c08d4a218375b2b95b8ed1666e8677c349906246c05", size = 455099, upload-time = "2025-10-14T15:05:34.189Z" }, + { url = "https://files.pythonhosted.org/packages/98/e0/8c9bdba88af756a2fce230dd365fab2baf927ba42cd47521ee7498fd5211/watchfiles-1.1.1-cp314-cp314-musllinux_1_1_aarch64.whl", hash = "sha256:74d5012b7630714b66be7b7b7a78855ef7ad58e8650c73afc4c076a1f480a8d6", size = 630626, upload-time = "2025-10-14T15:05:35.216Z" }, + { url = "https://files.pythonhosted.org/packages/2a/84/a95db05354bf2d19e438520d92a8ca475e578c647f78f53197f5a2f17aaf/watchfiles-1.1.1-cp314-cp314-musllinux_1_1_x86_64.whl", hash = "sha256:8fbe85cb3201c7d380d3d0b90e63d520f15d6afe217165d7f98c9c649654db81", size = 622519, upload-time = "2025-10-14T15:05:36.259Z" }, + { url = "https://files.pythonhosted.org/packages/1d/ce/d8acdc8de545de995c339be67711e474c77d643555a9bb74a9334252bd55/watchfiles-1.1.1-cp314-cp314-win32.whl", hash = "sha256:3fa0b59c92278b5a7800d3ee7733da9d096d4aabcfabb9a928918bd276ef9b9b", size = 272078, upload-time = "2025-10-14T15:05:37.63Z" }, + { url = "https://files.pythonhosted.org/packages/c4/c9/a74487f72d0451524be827e8edec251da0cc1fcf111646a511ae752e1a3d/watchfiles-1.1.1-cp314-cp314-win_amd64.whl", hash = "sha256:c2047d0b6cea13b3316bdbafbfa0c4228ae593d995030fda39089d36e64fc03a", size = 287664, upload-time = "2025-10-14T15:05:38.95Z" }, + { url = "https://files.pythonhosted.org/packages/df/b8/8ac000702cdd496cdce998c6f4ee0ca1f15977bba51bdf07d872ebdfc34c/watchfiles-1.1.1-cp314-cp314-win_arm64.whl", hash = "sha256:842178b126593addc05acf6fce960d28bc5fae7afbaa2c6c1b3a7b9460e5be02", size = 277154, upload-time = "2025-10-14T15:05:39.954Z" }, + { url = "https://files.pythonhosted.org/packages/47/a8/e3af2184707c29f0f14b1963c0aace6529f9d1b8582d5b99f31bbf42f59e/watchfiles-1.1.1-cp314-cp314t-macosx_10_12_x86_64.whl", hash = "sha256:88863fbbc1a7312972f1c511f202eb30866370ebb8493aef2812b9ff28156a21", size = 403820, upload-time = "2025-10-14T15:05:40.932Z" }, + { url = "https://files.pythonhosted.org/packages/c0/ec/e47e307c2f4bd75f9f9e8afbe3876679b18e1bcec449beca132a1c5ffb2d/watchfiles-1.1.1-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:55c7475190662e202c08c6c0f4d9e345a29367438cf8e8037f3155e10a88d5a5", size = 390510, upload-time = "2025-10-14T15:05:41.945Z" }, + { url = "https://files.pythonhosted.org/packages/d5/a0/ad235642118090f66e7b2f18fd5c42082418404a79205cdfca50b6309c13/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:3f53fa183d53a1d7a8852277c92b967ae99c2d4dcee2bfacff8868e6e30b15f7", size = 448408, upload-time = "2025-10-14T15:05:43.385Z" }, + { url = "https://files.pythonhosted.org/packages/df/85/97fa10fd5ff3332ae17e7e40e20784e419e28521549780869f1413742e9d/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:6aae418a8b323732fa89721d86f39ec8f092fc2af67f4217a2b07fd3e93c6101", size = 458968, upload-time = "2025-10-14T15:05:44.404Z" }, + { url = "https://files.pythonhosted.org/packages/47/c2/9059c2e8966ea5ce678166617a7f75ecba6164375f3b288e50a40dc6d489/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:f096076119da54a6080e8920cbdaac3dbee667eb91dcc5e5b78840b87415bd44", size = 488096, upload-time = "2025-10-14T15:05:45.398Z" }, + { url = "https://files.pythonhosted.org/packages/94/44/d90a9ec8ac309bc26db808a13e7bfc0e4e78b6fc051078a554e132e80160/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:00485f441d183717038ed2e887a7c868154f216877653121068107b227a2f64c", size = 596040, upload-time = "2025-10-14T15:05:46.502Z" }, + { url = "https://files.pythonhosted.org/packages/95/68/4e3479b20ca305cfc561db3ed207a8a1c745ee32bf24f2026a129d0ddb6e/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:a55f3e9e493158d7bfdb60a1165035f1cf7d320914e7b7ea83fe22c6023b58fc", size = 473847, upload-time = "2025-10-14T15:05:47.484Z" }, + { url = "https://files.pythonhosted.org/packages/4f/55/2af26693fd15165c4ff7857e38330e1b61ab8c37d15dc79118cdba115b7a/watchfiles-1.1.1-cp314-cp314t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:8c91ed27800188c2ae96d16e3149f199d62f86c7af5f5f4d2c61a3ed8cd3666c", size = 455072, upload-time = "2025-10-14T15:05:48.928Z" }, + { url = "https://files.pythonhosted.org/packages/66/1d/d0d200b10c9311ec25d2273f8aad8c3ef7cc7ea11808022501811208a750/watchfiles-1.1.1-cp314-cp314t-musllinux_1_1_aarch64.whl", hash = "sha256:311ff15a0bae3714ffb603e6ba6dbfba4065ab60865d15a6ec544133bdb21099", size = 629104, upload-time = "2025-10-14T15:05:49.908Z" }, + { url = "https://files.pythonhosted.org/packages/e3/bd/fa9bb053192491b3867ba07d2343d9f2252e00811567d30ae8d0f78136fe/watchfiles-1.1.1-cp314-cp314t-musllinux_1_1_x86_64.whl", hash = "sha256:a916a2932da8f8ab582f242c065f5c81bed3462849ca79ee357dd9551b0e9b01", size = 622112, upload-time = "2025-10-14T15:05:50.941Z" }, + { url = "https://files.pythonhosted.org/packages/d3/8e/e500f8b0b77be4ff753ac94dc06b33d8f0d839377fee1b78e8c8d8f031bf/watchfiles-1.1.1-pp311-pypy311_pp73-macosx_10_12_x86_64.whl", hash = "sha256:db476ab59b6765134de1d4fe96a1a9c96ddf091683599be0f26147ea1b2e4b88", size = 408250, upload-time = "2025-10-14T15:06:10.264Z" }, + { url = "https://files.pythonhosted.org/packages/bd/95/615e72cd27b85b61eec764a5ca51bd94d40b5adea5ff47567d9ebc4d275a/watchfiles-1.1.1-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:89eef07eee5e9d1fda06e38822ad167a044153457e6fd997f8a858ab7564a336", size = 396117, upload-time = "2025-10-14T15:06:11.28Z" }, + { url = "https://files.pythonhosted.org/packages/c9/81/e7fe958ce8a7fb5c73cc9fb07f5aeaf755e6aa72498c57d760af760c91f8/watchfiles-1.1.1-pp311-pypy311_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:ce19e06cbda693e9e7686358af9cd6f5d61312ab8b00488bc36f5aabbaf77e24", size = 450493, upload-time = "2025-10-14T15:06:12.321Z" }, + { url = "https://files.pythonhosted.org/packages/6e/d4/ed38dd3b1767193de971e694aa544356e63353c33a85d948166b5ff58b9e/watchfiles-1.1.1-pp311-pypy311_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:3e6f39af2eab0118338902798b5aa6664f46ff66bc0280de76fca67a7f262a49", size = 457546, upload-time = "2025-10-14T15:06:13.372Z" }, +] + +[[package]] +name = "wcwidth" +version = "0.6.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/35/a2/8e3becb46433538a38726c948d3399905a4c7cabd0df578ede5dc51f0ec2/wcwidth-0.6.0.tar.gz", hash = "sha256:cdc4e4262d6ef9a1a57e018384cbeb1208d8abbc64176027e2c2455c81313159", size = 159684, upload-time = "2026-02-06T19:19:40.919Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/68/5a/199c59e0a824a3db2b89c5d2dade7ab5f9624dbf6448dc291b46d5ec94d3/wcwidth-0.6.0-py3-none-any.whl", hash = "sha256:1a3a1e510b553315f8e146c54764f4fb6264ffad731b3d78088cdb1478ffbdad", size = 94189, upload-time = "2026-02-06T19:19:39.646Z" }, +] + +[[package]] +name = "webencodings" +version = "0.5.1" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/0b/02/ae6ceac1baeda530866a85075641cec12989bd8d31af6d5ab4a3e8c92f47/webencodings-0.5.1.tar.gz", hash = "sha256:b36a1c245f2d304965eb4e0a82848379241dc04b865afcc4aab16748587e1923", size = 9721, upload-time = "2017-04-05T20:21:34.189Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f4/24/2a3e3df732393fed8b3ebf2ec078f05546de641fe1b667ee316ec1dcf3b7/webencodings-0.5.1-py2.py3-none-any.whl", hash = "sha256:a0af1213f3c2226497a97e2b3aa01a7e4bee4f403f95be16fc9acd2947514a78", size = 11774, upload-time = "2017-04-05T20:21:32.581Z" }, +] + +[[package]] +name = "websockets" +version = "16.0" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/04/24/4b2031d72e840ce4c1ccb255f693b15c334757fc50023e4db9537080b8c4/websockets-16.0.tar.gz", hash = "sha256:5f6261a5e56e8d5c42a4497b364ea24d94d9563e8fbd44e78ac40879c60179b5", size = 179346, upload-time = "2026-01-10T09:23:47.181Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/f2/db/de907251b4ff46ae804ad0409809504153b3f30984daf82a1d84a9875830/websockets-16.0-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:31a52addea25187bde0797a97d6fc3d2f92b6f72a9370792d65a6e84615ac8a8", size = 177340, upload-time = "2026-01-10T09:22:34.539Z" }, + { url = "https://files.pythonhosted.org/packages/f3/fa/abe89019d8d8815c8781e90d697dec52523fb8ebe308bf11664e8de1877e/websockets-16.0-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:417b28978cdccab24f46400586d128366313e8a96312e4b9362a4af504f3bbad", size = 175022, upload-time = "2026-01-10T09:22:36.332Z" }, + { url = "https://files.pythonhosted.org/packages/58/5d/88ea17ed1ded2079358b40d31d48abe90a73c9e5819dbcde1606e991e2ad/websockets-16.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:af80d74d4edfa3cb9ed973a0a5ba2b2a549371f8a741e0800cb07becdd20f23d", size = 175319, upload-time = "2026-01-10T09:22:37.602Z" }, + { url = "https://files.pythonhosted.org/packages/d2/ae/0ee92b33087a33632f37a635e11e1d99d429d3d323329675a6022312aac2/websockets-16.0-cp311-cp311-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:08d7af67b64d29823fed316505a89b86705f2b7981c07848fb5e3ea3020c1abe", size = 184631, upload-time = "2026-01-10T09:22:38.789Z" }, + { url = "https://files.pythonhosted.org/packages/c8/c5/27178df583b6c5b31b29f526ba2da5e2f864ecc79c99dae630a85d68c304/websockets-16.0-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:7be95cfb0a4dae143eaed2bcba8ac23f4892d8971311f1b06f3c6b78952ee70b", size = 185870, upload-time = "2026-01-10T09:22:39.893Z" }, + { url = "https://files.pythonhosted.org/packages/87/05/536652aa84ddc1c018dbb7e2c4cbcd0db884580bf8e95aece7593fde526f/websockets-16.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:d6297ce39ce5c2e6feb13c1a996a2ded3b6832155fcfc920265c76f24c7cceb5", size = 185361, upload-time = "2026-01-10T09:22:41.016Z" }, + { url = "https://files.pythonhosted.org/packages/6d/e2/d5332c90da12b1e01f06fb1b85c50cfc489783076547415bf9f0a659ec19/websockets-16.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:1c1b30e4f497b0b354057f3467f56244c603a79c0d1dafce1d16c283c25f6e64", size = 184615, upload-time = "2026-01-10T09:22:42.442Z" }, + { url = "https://files.pythonhosted.org/packages/77/fb/d3f9576691cae9253b51555f841bc6600bf0a983a461c79500ace5a5b364/websockets-16.0-cp311-cp311-win32.whl", hash = "sha256:5f451484aeb5cafee1ccf789b1b66f535409d038c56966d6101740c1614b86c6", size = 178246, upload-time = "2026-01-10T09:22:43.654Z" }, + { url = "https://files.pythonhosted.org/packages/54/67/eaff76b3dbaf18dcddabc3b8c1dba50b483761cccff67793897945b37408/websockets-16.0-cp311-cp311-win_amd64.whl", hash = "sha256:8d7f0659570eefb578dacde98e24fb60af35350193e4f56e11190787bee77dac", size = 178684, upload-time = "2026-01-10T09:22:44.941Z" }, + { url = "https://files.pythonhosted.org/packages/84/7b/bac442e6b96c9d25092695578dda82403c77936104b5682307bd4deb1ad4/websockets-16.0-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:71c989cbf3254fbd5e84d3bff31e4da39c43f884e64f2551d14bb3c186230f00", size = 177365, upload-time = "2026-01-10T09:22:46.787Z" }, + { url = "https://files.pythonhosted.org/packages/b0/fe/136ccece61bd690d9c1f715baaeefd953bb2360134de73519d5df19d29ca/websockets-16.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:8b6e209ffee39ff1b6d0fa7bfef6de950c60dfb91b8fcead17da4ee539121a79", size = 175038, upload-time = "2026-01-10T09:22:47.999Z" }, + { url = "https://files.pythonhosted.org/packages/40/1e/9771421ac2286eaab95b8575b0cb701ae3663abf8b5e1f64f1fd90d0a673/websockets-16.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:86890e837d61574c92a97496d590968b23c2ef0aeb8a9bc9421d174cd378ae39", size = 175328, upload-time = "2026-01-10T09:22:49.809Z" }, + { url = "https://files.pythonhosted.org/packages/18/29/71729b4671f21e1eaa5d6573031ab810ad2936c8175f03f97f3ff164c802/websockets-16.0-cp312-cp312-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:9b5aca38b67492ef518a8ab76851862488a478602229112c4b0d58d63a7a4d5c", size = 184915, upload-time = "2026-01-10T09:22:51.071Z" }, + { url = "https://files.pythonhosted.org/packages/97/bb/21c36b7dbbafc85d2d480cd65df02a1dc93bf76d97147605a8e27ff9409d/websockets-16.0-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:e0334872c0a37b606418ac52f6ab9cfd17317ac26365f7f65e203e2d0d0d359f", size = 186152, upload-time = "2026-01-10T09:22:52.224Z" }, + { url = "https://files.pythonhosted.org/packages/4a/34/9bf8df0c0cf88fa7bfe36678dc7b02970c9a7d5e065a3099292db87b1be2/websockets-16.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:a0b31e0b424cc6b5a04b8838bbaec1688834b2383256688cf47eb97412531da1", size = 185583, upload-time = "2026-01-10T09:22:53.443Z" }, + { url = "https://files.pythonhosted.org/packages/47/88/4dd516068e1a3d6ab3c7c183288404cd424a9a02d585efbac226cb61ff2d/websockets-16.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:485c49116d0af10ac698623c513c1cc01c9446c058a4e61e3bf6c19dff7335a2", size = 184880, upload-time = "2026-01-10T09:22:55.033Z" }, + { url = "https://files.pythonhosted.org/packages/91/d6/7d4553ad4bf1c0421e1ebd4b18de5d9098383b5caa1d937b63df8d04b565/websockets-16.0-cp312-cp312-win32.whl", hash = "sha256:eaded469f5e5b7294e2bdca0ab06becb6756ea86894a47806456089298813c89", size = 178261, upload-time = "2026-01-10T09:22:56.251Z" }, + { url = "https://files.pythonhosted.org/packages/c3/f0/f3a17365441ed1c27f850a80b2bc680a0fa9505d733fe152fdf5e98c1c0b/websockets-16.0-cp312-cp312-win_amd64.whl", hash = "sha256:5569417dc80977fc8c2d43a86f78e0a5a22fee17565d78621b6bb264a115d4ea", size = 178693, upload-time = "2026-01-10T09:22:57.478Z" }, + { url = "https://files.pythonhosted.org/packages/cc/9c/baa8456050d1c1b08dd0ec7346026668cbc6f145ab4e314d707bb845bf0d/websockets-16.0-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:878b336ac47938b474c8f982ac2f7266a540adc3fa4ad74ae96fea9823a02cc9", size = 177364, upload-time = "2026-01-10T09:22:59.333Z" }, + { url = "https://files.pythonhosted.org/packages/7e/0c/8811fc53e9bcff68fe7de2bcbe75116a8d959ac699a3200f4847a8925210/websockets-16.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:52a0fec0e6c8d9a784c2c78276a48a2bdf099e4ccc2a4cad53b27718dbfd0230", size = 175039, upload-time = "2026-01-10T09:23:01.171Z" }, + { url = "https://files.pythonhosted.org/packages/aa/82/39a5f910cb99ec0b59e482971238c845af9220d3ab9fa76dd9162cda9d62/websockets-16.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:e6578ed5b6981005df1860a56e3617f14a6c307e6a71b4fff8c48fdc50f3ed2c", size = 175323, upload-time = "2026-01-10T09:23:02.341Z" }, + { url = "https://files.pythonhosted.org/packages/bd/28/0a25ee5342eb5d5f297d992a77e56892ecb65e7854c7898fb7d35e9b33bd/websockets-16.0-cp313-cp313-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:95724e638f0f9c350bb1c2b0a7ad0e83d9cc0c9259f3ea94e40d7b02a2179ae5", size = 184975, upload-time = "2026-01-10T09:23:03.756Z" }, + { url = "https://files.pythonhosted.org/packages/f9/66/27ea52741752f5107c2e41fda05e8395a682a1e11c4e592a809a90c6a506/websockets-16.0-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:c0204dc62a89dc9d50d682412c10b3542d748260d743500a85c13cd1ee4bde82", size = 186203, upload-time = "2026-01-10T09:23:05.01Z" }, + { url = "https://files.pythonhosted.org/packages/37/e5/8e32857371406a757816a2b471939d51c463509be73fa538216ea52b792a/websockets-16.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:52ac480f44d32970d66763115edea932f1c5b1312de36df06d6b219f6741eed8", size = 185653, upload-time = "2026-01-10T09:23:06.301Z" }, + { url = "https://files.pythonhosted.org/packages/9b/67/f926bac29882894669368dc73f4da900fcdf47955d0a0185d60103df5737/websockets-16.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:6e5a82b677f8f6f59e8dfc34ec06ca6b5b48bc4fcda346acd093694cc2c24d8f", size = 184920, upload-time = "2026-01-10T09:23:07.492Z" }, + { url = "https://files.pythonhosted.org/packages/3c/a1/3d6ccdcd125b0a42a311bcd15a7f705d688f73b2a22d8cf1c0875d35d34a/websockets-16.0-cp313-cp313-win32.whl", hash = "sha256:abf050a199613f64c886ea10f38b47770a65154dc37181bfaff70c160f45315a", size = 178255, upload-time = "2026-01-10T09:23:09.245Z" }, + { url = "https://files.pythonhosted.org/packages/6b/ae/90366304d7c2ce80f9b826096a9e9048b4bb760e44d3b873bb272cba696b/websockets-16.0-cp313-cp313-win_amd64.whl", hash = "sha256:3425ac5cf448801335d6fdc7ae1eb22072055417a96cc6b31b3861f455fbc156", size = 178689, upload-time = "2026-01-10T09:23:10.483Z" }, + { url = "https://files.pythonhosted.org/packages/f3/1d/e88022630271f5bd349ed82417136281931e558d628dd52c4d8621b4a0b2/websockets-16.0-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:8cc451a50f2aee53042ac52d2d053d08bf89bcb31ae799cb4487587661c038a0", size = 177406, upload-time = "2026-01-10T09:23:12.178Z" }, + { url = "https://files.pythonhosted.org/packages/f2/78/e63be1bf0724eeb4616efb1ae1c9044f7c3953b7957799abb5915bffd38e/websockets-16.0-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:daa3b6ff70a9241cf6c7fc9e949d41232d9d7d26fd3522b1ad2b4d62487e9904", size = 175085, upload-time = "2026-01-10T09:23:13.511Z" }, + { url = "https://files.pythonhosted.org/packages/bb/f4/d3c9220d818ee955ae390cf319a7c7a467beceb24f05ee7aaaa2414345ba/websockets-16.0-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:fd3cb4adb94a2a6e2b7c0d8d05cb94e6f1c81a0cf9dc2694fb65c7e8d94c42e4", size = 175328, upload-time = "2026-01-10T09:23:14.727Z" }, + { url = "https://files.pythonhosted.org/packages/63/bc/d3e208028de777087e6fb2b122051a6ff7bbcca0d6df9d9c2bf1dd869ae9/websockets-16.0-cp314-cp314-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:781caf5e8eee67f663126490c2f96f40906594cb86b408a703630f95550a8c3e", size = 185044, upload-time = "2026-01-10T09:23:15.939Z" }, + { url = "https://files.pythonhosted.org/packages/ad/6e/9a0927ac24bd33a0a9af834d89e0abc7cfd8e13bed17a86407a66773cc0e/websockets-16.0-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:caab51a72c51973ca21fa8a18bd8165e1a0183f1ac7066a182ff27107b71e1a4", size = 186279, upload-time = "2026-01-10T09:23:17.148Z" }, + { url = "https://files.pythonhosted.org/packages/b9/ca/bf1c68440d7a868180e11be653c85959502efd3a709323230314fda6e0b3/websockets-16.0-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:19c4dc84098e523fd63711e563077d39e90ec6702aff4b5d9e344a60cb3c0cb1", size = 185711, upload-time = "2026-01-10T09:23:18.372Z" }, + { url = "https://files.pythonhosted.org/packages/c4/f8/fdc34643a989561f217bb477cbc47a3a07212cbda91c0e4389c43c296ebf/websockets-16.0-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:a5e18a238a2b2249c9a9235466b90e96ae4795672598a58772dd806edc7ac6d3", size = 184982, upload-time = "2026-01-10T09:23:19.652Z" }, + { url = "https://files.pythonhosted.org/packages/dd/d1/574fa27e233764dbac9c52730d63fcf2823b16f0856b3329fc6268d6ae4f/websockets-16.0-cp314-cp314-win32.whl", hash = "sha256:a069d734c4a043182729edd3e9f247c3b2a4035415a9172fd0f1b71658a320a8", size = 177915, upload-time = "2026-01-10T09:23:21.458Z" }, + { url = "https://files.pythonhosted.org/packages/8a/f1/ae6b937bf3126b5134ce1f482365fde31a357c784ac51852978768b5eff4/websockets-16.0-cp314-cp314-win_amd64.whl", hash = "sha256:c0ee0e63f23914732c6d7e0cce24915c48f3f1512ec1d079ed01fc629dab269d", size = 178381, upload-time = "2026-01-10T09:23:22.715Z" }, + { url = "https://files.pythonhosted.org/packages/06/9b/f791d1db48403e1f0a27577a6beb37afae94254a8c6f08be4a23e4930bc0/websockets-16.0-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:a35539cacc3febb22b8f4d4a99cc79b104226a756aa7400adc722e83b0d03244", size = 177737, upload-time = "2026-01-10T09:23:24.523Z" }, + { url = "https://files.pythonhosted.org/packages/bd/40/53ad02341fa33b3ce489023f635367a4ac98b73570102ad2cdd770dacc9a/websockets-16.0-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:b784ca5de850f4ce93ec85d3269d24d4c82f22b7212023c974c401d4980ebc5e", size = 175268, upload-time = "2026-01-10T09:23:25.781Z" }, + { url = "https://files.pythonhosted.org/packages/74/9b/6158d4e459b984f949dcbbb0c5d270154c7618e11c01029b9bbd1bb4c4f9/websockets-16.0-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:569d01a4e7fba956c5ae4fc988f0d4e187900f5497ce46339c996dbf24f17641", size = 175486, upload-time = "2026-01-10T09:23:27.033Z" }, + { url = "https://files.pythonhosted.org/packages/e5/2d/7583b30208b639c8090206f95073646c2c9ffd66f44df967981a64f849ad/websockets-16.0-cp314-cp314t-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:50f23cdd8343b984957e4077839841146f67a3d31ab0d00e6b824e74c5b2f6e8", size = 185331, upload-time = "2026-01-10T09:23:28.259Z" }, + { url = "https://files.pythonhosted.org/packages/45/b0/cce3784eb519b7b5ad680d14b9673a31ab8dcb7aad8b64d81709d2430aa8/websockets-16.0-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:152284a83a00c59b759697b7f9e9cddf4e3c7861dd0d964b472b70f78f89e80e", size = 186501, upload-time = "2026-01-10T09:23:29.449Z" }, + { url = "https://files.pythonhosted.org/packages/19/60/b8ebe4c7e89fb5f6cdf080623c9d92789a53636950f7abacfc33fe2b3135/websockets-16.0-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:bc59589ab64b0022385f429b94697348a6a234e8ce22544e3681b2e9331b5944", size = 186062, upload-time = "2026-01-10T09:23:31.368Z" }, + { url = "https://files.pythonhosted.org/packages/88/a8/a080593f89b0138b6cba1b28f8df5673b5506f72879322288b031337c0b8/websockets-16.0-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:32da954ffa2814258030e5a57bc73a3635463238e797c7375dc8091327434206", size = 185356, upload-time = "2026-01-10T09:23:32.627Z" }, + { url = "https://files.pythonhosted.org/packages/c2/b6/b9afed2afadddaf5ebb2afa801abf4b0868f42f8539bfe4b071b5266c9fe/websockets-16.0-cp314-cp314t-win32.whl", hash = "sha256:5a4b4cc550cb665dd8a47f868c8d04c8230f857363ad3c9caf7a0c3bf8c61ca6", size = 178085, upload-time = "2026-01-10T09:23:33.816Z" }, + { url = "https://files.pythonhosted.org/packages/9f/3e/28135a24e384493fa804216b79a6a6759a38cc4ff59118787b9fb693df93/websockets-16.0-cp314-cp314t-win_amd64.whl", hash = "sha256:b14dc141ed6d2dde437cddb216004bcac6a1df0935d79656387bd41632ba0bbd", size = 178531, upload-time = "2026-01-10T09:23:35.016Z" }, + { url = "https://files.pythonhosted.org/packages/72/07/c98a68571dcf256e74f1f816b8cc5eae6eb2d3d5cfa44d37f801619d9166/websockets-16.0-pp311-pypy311_pp73-macosx_10_15_x86_64.whl", hash = "sha256:349f83cd6c9a415428ee1005cadb5c2c56f4389bc06a9af16103c3bc3dcc8b7d", size = 174947, upload-time = "2026-01-10T09:23:36.166Z" }, + { url = "https://files.pythonhosted.org/packages/7e/52/93e166a81e0305b33fe416338be92ae863563fe7bce446b0f687b9df5aea/websockets-16.0-pp311-pypy311_pp73-macosx_11_0_arm64.whl", hash = "sha256:4a1aba3340a8dca8db6eb5a7986157f52eb9e436b74813764241981ca4888f03", size = 175260, upload-time = "2026-01-10T09:23:37.409Z" }, + { url = "https://files.pythonhosted.org/packages/56/0c/2dbf513bafd24889d33de2ff0368190a0e69f37bcfa19009ef819fe4d507/websockets-16.0-pp311-pypy311_pp73-manylinux1_x86_64.manylinux_2_28_x86_64.manylinux_2_5_x86_64.whl", hash = "sha256:f4a32d1bd841d4bcbffdcb3d2ce50c09c3909fbead375ab28d0181af89fd04da", size = 176071, upload-time = "2026-01-10T09:23:39.158Z" }, + { url = "https://files.pythonhosted.org/packages/a5/8f/aea9c71cc92bf9b6cc0f7f70df8f0b420636b6c96ef4feee1e16f80f75dd/websockets-16.0-pp311-pypy311_pp73-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:0298d07ee155e2e9fda5be8a9042200dd2e3bb0b8a38482156576f863a9d457c", size = 176968, upload-time = "2026-01-10T09:23:41.031Z" }, + { url = "https://files.pythonhosted.org/packages/9a/3f/f70e03f40ffc9a30d817eef7da1be72ee4956ba8d7255c399a01b135902a/websockets-16.0-pp311-pypy311_pp73-win_amd64.whl", hash = "sha256:a653aea902e0324b52f1613332ddf50b00c06fdaf7e92624fbf8c77c78fa5767", size = 178735, upload-time = "2026-01-10T09:23:42.259Z" }, + { url = "https://files.pythonhosted.org/packages/6f/28/258ebab549c2bf3e64d2b0217b973467394a9cea8c42f70418ca2c5d0d2e/websockets-16.0-py3-none-any.whl", hash = "sha256:1637db62fad1dc833276dded54215f2c7fa46912301a24bd94d45d46a011ceec", size = 171598, upload-time = "2026-01-10T09:23:45.395Z" }, +] + +[[package]] +name = "widgetsnbextension" +version = "4.0.15" +source = { registry = "https://pypi.org/simple" } +sdist = { url = "https://files.pythonhosted.org/packages/bd/f4/c67440c7fb409a71b7404b7aefcd7569a9c0d6bd071299bf4198ae7a5d95/widgetsnbextension-4.0.15.tar.gz", hash = "sha256:de8610639996f1567952d763a5a41af8af37f2575a41f9852a38f947eb82a3b9", size = 1097402, upload-time = "2025-11-01T21:15:55.178Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/3f/0e/fa3b193432cfc60c93b42f3be03365f5f909d2b3ea410295cf36df739e31/widgetsnbextension-4.0.15-py3-none-any.whl", hash = "sha256:8156704e4346a571d9ce73b84bee86a29906c9abfd7223b7228a28899ccf3366", size = 2196503, upload-time = "2025-11-01T21:15:53.565Z" }, +] + +[[package]] +name = "wsproto" +version = "1.3.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "h11" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/c7/79/12135bdf8b9c9367b8701c2c19a14c913c120b882d50b014ca0d38083c2c/wsproto-1.3.2.tar.gz", hash = "sha256:b86885dcf294e15204919950f666e06ffc6c7c114ca900b060d6e16293528294", size = 50116, upload-time = "2025-11-20T18:18:01.871Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/a4/f5/10b68b7b1544245097b2a1b8238f66f2fc6dcaeb24ba5d917f52bd2eed4f/wsproto-1.3.2-py3-none-any.whl", hash = "sha256:61eea322cdf56e8cc904bd3ad7573359a242ba65688716b0710a5eb12beab584", size = 24405, upload-time = "2025-11-20T18:18:00.454Z" }, +] + +[[package]] +name = "yarl" +version = "1.24.2" +source = { registry = "https://pypi.org/simple" } +dependencies = [ + { name = "idna" }, + { name = "multidict" }, + { name = "propcache" }, +] +sdist = { url = "https://files.pythonhosted.org/packages/79/12/1e8f37460ea0f7eb59c221fdaf0ed75e7ac43e97f8093b9c6f411df50a78/yarl-1.24.2.tar.gz", hash = "sha256:9ac374123c6fd7abf64d1fec93962b0bd4ee2c19751755a762a72dd96c0378f8", size = 210798, upload-time = "2026-05-19T21:31:05.599Z" } +wheels = [ + { url = "https://files.pythonhosted.org/packages/c5/c5/1ce244152ff2839645e7cae92f90e7bafcb2c52bea7ff586ac714f14f5df/yarl-1.24.2-cp311-cp311-macosx_10_9_universal2.whl", hash = "sha256:36348bebb147b83818b9d7e673ea4debc75970afc6ffdc7e3975ad05ce5a58c1", size = 128971, upload-time = "2026-05-19T21:28:20.543Z" }, + { url = "https://files.pythonhosted.org/packages/87/5a/00f36967203ed89cb3acd2c8ed526cc3fed9418eb70ce128160a911c8499/yarl-1.24.2-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:1a97e42c8a2233f2f279ecadd9e4a037bcb5d813b78435e8eedd4db5a9e9708c", size = 91507, upload-time = "2026-05-19T21:28:22.556Z" }, + { url = "https://files.pythonhosted.org/packages/31/d0/1fb0c1cd27288f39f6974da4318c32768d72c9890984541fdf1e2e32a51d/yarl-1.24.2-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:8d027d56f1035e339d1001ac33eceab5b2ec8e42e449787bb75e289fb9a5cd1d", size = 91343, upload-time = "2026-05-19T21:28:24.092Z" }, + { url = "https://files.pythonhosted.org/packages/03/ce/d4a646508bed2f8dec6435b40166fe9308dd191262033d3f307b2bbcaecd/yarl-1.24.2-cp311-cp311-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:0a6377060e7927187a42b7eb202090cbe2b34933a4eeaf90e3bd9e33432e5cae", size = 105704, upload-time = "2026-05-19T21:28:25.872Z" }, + { url = "https://files.pythonhosted.org/packages/4b/07/b3278e82d8bc41485bcf6d856cd0433262593de615b1d3dc43bd3f5bead4/yarl-1.24.2-cp311-cp311-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:17076578bce0049a5ce57d14ad1bded391b68a3b213e9b81b0097b090244999a", size = 97281, upload-time = "2026-05-19T21:28:27.352Z" }, + { url = "https://files.pythonhosted.org/packages/17/5b/4cee6e7c92e487bebe7afc797da0aa54a248ab4e776a68fe369ec29665a5/yarl-1.24.2-cp311-cp311-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:50713f1d4d6be6375bb178bb43d140ee1acb8abe589cd723320b7925a275be1e", size = 114020, upload-time = "2026-05-19T21:28:29.458Z" }, + { url = "https://files.pythonhosted.org/packages/5c/82/111076571545a7d4f9cca3fbd5c6f40615af58642be09f12328f48022468/yarl-1.24.2-cp311-cp311-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:34263e2fa8fb5bb63a0d97706cda38edbad62fddb58c7f12d6acbc092812aa50", size = 111450, upload-time = "2026-05-19T21:28:31.262Z" }, + { url = "https://files.pythonhosted.org/packages/b6/ec/08f671f69a444d704aeecebf92af659b67b97a869942411d0a578b08c334/yarl-1.24.2-cp311-cp311-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:49016d82f032b1bd1e10b01078a7d29ae71bf468eeae0ea22df8bab691e60003", size = 106384, upload-time = "2026-05-19T21:28:32.856Z" }, + { url = "https://files.pythonhosted.org/packages/e5/86/ce41e7a7a199340b2330d52b60f25c4074b6636dd0e60b1a80d31a9db042/yarl-1.24.2-cp311-cp311-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:3f6d2c216318f8f32038ca3f72501ba08536f0fd18a36e858836b121b2deed9f", size = 106153, upload-time = "2026-05-19T21:28:35.222Z" }, + { url = "https://files.pythonhosted.org/packages/c4/5d/31be8a729531ab3e55ac3e7e5c800be8c89ea98947f418b2f6ea259fb6ee/yarl-1.24.2-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:08d3a33218e0c64393e7610284e770409a9c31c429b078bcb24096ed0a783b8f", size = 105322, upload-time = "2026-05-19T21:28:36.642Z" }, + { url = "https://files.pythonhosted.org/packages/47/9b/b57afb22b386ae87ac9940f09878b98d8c333f89113e6fc96fcf4ca9eb64/yarl-1.24.2-cp311-cp311-musllinux_1_2_armv7l.whl", hash = "sha256:5d699376c4ca3cba49bbfae3a05b5b70ded572937171ce1e0b8d87118e2ba294", size = 99057, upload-time = "2026-05-19T21:28:38.386Z" }, + { url = "https://files.pythonhosted.org/packages/a3/4f/06348c27c8389256c313e8a57d796808fc0264c915dd5e7cfd3c0e314dc7/yarl-1.24.2-cp311-cp311-musllinux_1_2_ppc64le.whl", hash = "sha256:a1cab588b4fa14bea2e55ebea27478adfb05372f47573738e1acc4a36c0b05d2", size = 113502, upload-time = "2026-05-19T21:28:40.091Z" }, + { url = "https://files.pythonhosted.org/packages/5f/1c/284f307b298e4a17b7943b07d9d7ecc4151537f8d137ba51f3bb6c31ca20/yarl-1.24.2-cp311-cp311-musllinux_1_2_riscv64.whl", hash = "sha256:ec87ccc31bd21db7ad009d8572c127c1000f268517618a4cc09adba3c2a7f21c", size = 105253, upload-time = "2026-05-19T21:28:41.987Z" }, + { url = "https://files.pythonhosted.org/packages/c8/bf/0de123bec8619e45c80cbded9085f61b5b4a9eddb8abe6d25d28ee1ec866/yarl-1.24.2-cp311-cp311-musllinux_1_2_s390x.whl", hash = "sha256:d1dd47a22843b212baa8d74f37796815d43bd046b42a0f41e9da433386c3136b", size = 111345, upload-time = "2026-05-19T21:28:43.93Z" }, + { url = "https://files.pythonhosted.org/packages/90/af/0248eb065e51129d2a9b2436cd1b5c772c19a6b04e5b6a186955671e3319/yarl-1.24.2-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:7b54b9c67c2b06bd7b9a77253d242124b9c95d2c02def5a1144001ee547dd9d5", size = 106558, upload-time = "2026-05-19T21:28:45.806Z" }, + { url = "https://files.pythonhosted.org/packages/21/3c/f960d7a65ef97d8ba9b424fb5128796a4bc710fc6df2ddbbd7dfdc3bbd20/yarl-1.24.2-cp311-cp311-win_amd64.whl", hash = "sha256:f8fdbcff8b2c7c9284e60c196f693588598ddcee31e11c18e14949ce44519d45", size = 92808, upload-time = "2026-05-19T21:28:48.465Z" }, + { url = "https://files.pythonhosted.org/packages/03/1a/49fb03750e4de4d2284cd5b885a383133c34eef45bd59631b2bb8b7e81e8/yarl-1.24.2-cp311-cp311-win_arm64.whl", hash = "sha256:b32c37a7a337e90822c45797bf3d79d60875cfcccd3ecc80e9f453d87026c122", size = 87610, upload-time = "2026-05-19T21:28:50.07Z" }, + { url = "https://files.pythonhosted.org/packages/f0/da/866bcb01076ba49d2b42b309867bed3826421f1c479655eb7a607b44f20b/yarl-1.24.2-cp312-cp312-macosx_10_13_universal2.whl", hash = "sha256:b975866c184564c827e0877380f0dae57dcca7e52782128381b72feff6dfceb8", size = 129957, upload-time = "2026-05-19T21:28:51.695Z" }, + { url = "https://files.pythonhosted.org/packages/bf/1d/fcefb70922ea2268a8971d8e5874d9a8218644200fb8465f1dcad55e6851/yarl-1.24.2-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:3b075301a2836a0e297b1b658cb6d6135df535d62efefdd60366bd589c2c82f2", size = 92164, upload-time = "2026-05-19T21:28:53.242Z" }, + { url = "https://files.pythonhosted.org/packages/29/b6/170e2b8d4e3bc30e6bfdcca53556537f5bf595e938632dfcb059311f3ff6/yarl-1.24.2-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:8ae44649b00947634ab0dab2a374a638f52923a6e67083f2c156cd5cbd1a881d", size = 91688, upload-time = "2026-05-19T21:28:54.865Z" }, + { url = "https://files.pythonhosted.org/packages/fe/a5/c9f655d5553ea0b99fdac9d6a99ad3f9b3e73b8e5758bb46f58c9831f74c/yarl-1.24.2-cp312-cp312-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:507cc19f0b45454e2d6dcd62ff7d062b9f77a2812404e62dbdaec05b50faa035", size = 102902, upload-time = "2026-05-19T21:28:56.963Z" }, + { url = "https://files.pythonhosted.org/packages/5d/bc/6b9664d815d79af4ee553337f9d606c56bbf269186ada9172de45f1b5f60/yarl-1.24.2-cp312-cp312-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:c4c17bad5a530912d2111825d3f05e89bab2dd376aaa8cbc77e449e6db63e576", size = 97931, upload-time = "2026-05-19T21:28:58.56Z" }, + { url = "https://files.pythonhosted.org/packages/98/ec/32ba48acae30fecd60928f5791188b80a9d6ee3840507ffda29fecd37b71/yarl-1.24.2-cp312-cp312-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:f5f0cbb112838a4a293985b6ed73948a547dadcc1ba6d2089938e7abdedceef8", size = 111030, upload-time = "2026-05-19T21:29:00.148Z" }, + { url = "https://files.pythonhosted.org/packages/82/5a/6f4cd081e5f4934d2ae3a8ef4abe3afacc010d26f0035ee91b35cd7d7c37/yarl-1.24.2-cp312-cp312-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:5ec8356b8a6afcf81fc7aeeef13b1ff7a49dec00f313394bbb9e83830d32ccd7", size = 110392, upload-time = "2026-05-19T21:29:02.155Z" }, + { url = "https://files.pythonhosted.org/packages/7a/da/323a01c349bd5fb01bb6652e314d9bb218cee630a736bdb810ad50e4013f/yarl-1.24.2-cp312-cp312-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:7e7ebcdef69dec6c6451e616f32b622a6d4a2e92b445c992f7c8e5274a6bbc4c", size = 105612, upload-time = "2026-05-19T21:29:04.247Z" }, + { url = "https://files.pythonhosted.org/packages/7c/80/264ab684f181e1a876389374519ff05d10248725535ae2ac4e8ac4e563d6/yarl-1.24.2-cp312-cp312-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:47a55d6cf6db2f401017a9e96e5288844e5051911fb4e0c8311a3980f5e59a7d", size = 104487, upload-time = "2026-05-19T21:29:06.491Z" }, + { url = "https://files.pythonhosted.org/packages/41/07/efabe5df87e96d7ad5959760b888344be48cd6884db127b407c6b5503adc/yarl-1.24.2-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:3065657c80a2321225e804048597ad55658a7e76b32d6f5ee4074d04c50401db", size = 102333, upload-time = "2026-05-19T21:29:08.267Z" }, + { url = "https://files.pythonhosted.org/packages/44/0c/bcf7c42603e1009295f586d8890f2ba032c8b53310e815adf0a202c73d9f/yarl-1.24.2-cp312-cp312-musllinux_1_2_armv7l.whl", hash = "sha256:cb84b80d88e19ede158619b80813968713d8d008b0e2497a576e6a0557d50712", size = 99025, upload-time = "2026-05-19T21:29:10.682Z" }, + { url = "https://files.pythonhosted.org/packages/4f/82/84482ab1a57a0f21a08afe6a7004c61d741f8f2ecc3b05c321577c612164/yarl-1.24.2-cp312-cp312-musllinux_1_2_ppc64le.whl", hash = "sha256:990de4f680b1c217e77ff0d6aa0029f9eb79889c11fb3e9a3942c7eba29c1996", size = 110507, upload-time = "2026-05-19T21:29:12.954Z" }, + { url = "https://files.pythonhosted.org/packages/c4/8d/a546ba1dfe1b0f290e05fef145cd07614c0f15df1a707195e512d1e39d1d/yarl-1.24.2-cp312-cp312-musllinux_1_2_riscv64.whl", hash = "sha256:abb8ec0323b80161e3802da3150ef660b41d0e9be2048b76a363d93eee992c2b", size = 103719, upload-time = "2026-05-19T21:29:14.893Z" }, + { url = "https://files.pythonhosted.org/packages/1a/b6/267f2a09213138473adfce6b8a6e17791d7fee70bd4d9003218e4dec58b0/yarl-1.24.2-cp312-cp312-musllinux_1_2_s390x.whl", hash = "sha256:e7977781f83638a4c73e0f88425563d70173e0dfd90ac006a45c65036293ee3c", size = 110438, upload-time = "2026-05-19T21:29:16.485Z" }, + { url = "https://files.pythonhosted.org/packages/48/2d/1c8d89c7c5f9cad9fb2902445d94e2ab1d7aa35de029afbb8ae95c42d00f/yarl-1.24.2-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:e30dd55825dc554ec5b66a94953b8eda8745926514c5089dfcacecb9c99b5bd1", size = 105719, upload-time = "2026-05-19T21:29:18.367Z" }, + { url = "https://files.pythonhosted.org/packages/a7/25/722e3b93bd687009afb2d59a35e13d30ddd8f80571445bb0c4e4ce26ec66/yarl-1.24.2-cp312-cp312-win_amd64.whl", hash = "sha256:7dafe10c12ddd4d120d528c4b5599c953bd7b12845347d507b95451195bb6cad", size = 92901, upload-time = "2026-05-19T21:29:20.014Z" }, + { url = "https://files.pythonhosted.org/packages/39/47/4486ccfb674c04854a1ef8aa77868b6a6f765feaf69633409d7ca4f02cb8/yarl-1.24.2-cp312-cp312-win_arm64.whl", hash = "sha256:044a09d8401fcf8681977faef6d286b8ade1e2d2e9dceda175d1cfa5ca496f30", size = 87229, upload-time = "2026-05-19T21:29:22.1Z" }, + { url = "https://files.pythonhosted.org/packages/82/62/fcf0ce677f17e5c471c06311dd25964be38a4c586993632910d2e75278bc/yarl-1.24.2-cp313-cp313-macosx_10_13_universal2.whl", hash = "sha256:491ac9141decf49ee8030199e1ee251cdff0e131f25678817ff6aa5f837a3536", size = 128978, upload-time = "2026-05-19T21:29:23.83Z" }, + { url = "https://files.pythonhosted.org/packages/d3/58/8e63299bb71ed61a834121d9d3fe6c9fcf2a6a5d09754ff4f20f2d20baf5/yarl-1.24.2-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:e89418f65eda18f99030386305bd44d7d504e328a7945db1ead514fbe03a0607", size = 91733, upload-time = "2026-05-19T21:29:25.375Z" }, + { url = "https://files.pythonhosted.org/packages/c1/24/16748d5dab6daec8b0ed81ccec639a1cded0f18dcc62a4f696b4fe366c37/yarl-1.24.2-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:cdfcce633b4a4bb8281913c57fcafd4b5933fbc19111a5e3930bbd299d6102f1", size = 91113, upload-time = "2026-05-19T21:29:26.928Z" }, + { url = "https://files.pythonhosted.org/packages/1b/66/b63fff7b71211e866624b21432d5943cbb633eb0c2872d9ee3070648f22c/yarl-1.24.2-cp313-cp313-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:863297ddede92ee49024e9a9b11ecb59f310ca85b60d8537f56bed9bbb5b1986", size = 103899, upload-time = "2026-05-19T21:29:28.842Z" }, + { url = "https://files.pythonhosted.org/packages/9d/ac/ba1974b8533909636f7733fe86cf677e3619527c3c2fa913e0ea89c48757/yarl-1.24.2-cp313-cp313-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:374423f70754a2c96942ede36a29d37dc6b0cb8f92f8d009ddf3ed78d3da5488", size = 97862, upload-time = "2026-05-19T21:29:31.086Z" }, + { url = "https://files.pythonhosted.org/packages/1b/a5/123ac993b5c2ba6f554a140305620cb8f150fa543711bbc49be3ec0a65a4/yarl-1.24.2-cp313-cp313-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:33a29b5d00ccbf3219bb3e351d7875739c19481e030779f48cc46a7a71681a9b", size = 111060, upload-time = "2026-05-19T21:29:32.657Z" }, + { url = "https://files.pythonhosted.org/packages/23/37/c472d3af3509688392134a88a825276770a187f1daa4de3f6dc0a327a751/yarl-1.24.2-cp313-cp313-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:a9532c57211730c515341af11fef6e9b61d157487272a096d0c04da445642592", size = 110613, upload-time = "2026-05-19T21:29:34.379Z" }, + { url = "https://files.pythonhosted.org/packages/df/88/09c28dad91e662ccfaa1b78f1c57badde74fc9d0b23e74aef644750ecd73/yarl-1.24.2-cp313-cp313-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:91e72cf093fd833483a97ee648e0c053c7c629f51ff4a0e7edd84f806b0c5617", size = 107012, upload-time = "2026-05-19T21:29:36.216Z" }, + { url = "https://files.pythonhosted.org/packages/07/ab/9d4f69d571a94f4d112fa7e2e007200f5a54d319f58c82ac7b7baa61f5c6/yarl-1.24.2-cp313-cp313-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:b3177bc0a768ef3bacceb4f272632990b7bea352f1b2f1eee9d6d6ff16516f92", size = 105887, upload-time = "2026-05-19T21:29:38.746Z" }, + { url = "https://files.pythonhosted.org/packages/8e/9a/000b2b66c0d772a499fc531d21dab92dfeb73b640a12eed6ba89f49bb2d0/yarl-1.24.2-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:e196952aacaf3b232e265ff02980b64d483dc0972bd49bcb061171ff22ac203a", size = 103620, upload-time = "2026-05-19T21:29:40.368Z" }, + { url = "https://files.pythonhosted.org/packages/41/7c/7c1050f73450fbdaa3f0c72017059f00ce5e13366692f3dba25275a1083d/yarl-1.24.2-cp313-cp313-musllinux_1_2_armv7l.whl", hash = "sha256:204e7a61ce99919c0de1bf904ab5d7aa188a129ea8f690a8f76cfb6e2844dc44", size = 100599, upload-time = "2026-05-19T21:29:42.66Z" }, + { url = "https://files.pythonhosted.org/packages/ec/b1/29e5756b3926705f5f6089bd5b9f50a56eaac550da6e260bf713ead44d04/yarl-1.24.2-cp313-cp313-musllinux_1_2_ppc64le.whl", hash = "sha256:4b156914620f0b9d78dc1adb3751141daee561cfec796088abb89ed49d220f1a", size = 110604, upload-time = "2026-05-19T21:29:44.632Z" }, + { url = "https://files.pythonhosted.org/packages/a3/4b/8415bc96e9b150cde942fbac9a8182985e58f40ce5c54c34ed015407d3ee/yarl-1.24.2-cp313-cp313-musllinux_1_2_riscv64.whl", hash = "sha256:8372a2b976cf70654b2be6619ab6068acabb35f724c0fda7b277fbf53d66a5cf", size = 105161, upload-time = "2026-05-19T21:29:46.755Z" }, + { url = "https://files.pythonhosted.org/packages/8b/d4/cde059abfa229553b7298a2eadde2752e723d50aeedaef86ce59da2718ee/yarl-1.24.2-cp313-cp313-musllinux_1_2_s390x.whl", hash = "sha256:f9a1e9b622ca284143aab5d885848686dcd85453bb1ca9abcdb7503e64dc0056", size = 110619, upload-time = "2026-05-19T21:29:48.972Z" }, + { url = "https://files.pythonhosted.org/packages/e7/2c/d6a6c9a61549f7b6c7e6dc6937d195bcf069582b47b7200dcd0e7b256acf/yarl-1.24.2-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:810e19b685c8c3c5862f6a38160a1f4e4c0916c9390024ec347b6157a45a0992", size = 107362, upload-time = "2026-05-19T21:29:51Z" }, + { url = "https://files.pythonhosted.org/packages/92/dd/3ae5fe417e9d1c353a548553326eb9935e76b6b727161563b424cc296df3/yarl-1.24.2-cp313-cp313-win_amd64.whl", hash = "sha256:7d37fb7c38f2b6edab0f845c4f85148d4c44204f52bc127021bd2bc9fdbf1656", size = 92667, upload-time = "2026-05-19T21:29:52.743Z" }, + { url = "https://files.pythonhosted.org/packages/10/cc/a7beb239f78f27fca1b053c8e8595e4179c02e62249b4687ec218c370c50/yarl-1.24.2-cp313-cp313-win_arm64.whl", hash = "sha256:1e831894be7c2954240e49791fa4b50c05a0dc881de2552cfe3ffd8631c7f461", size = 87069, upload-time = "2026-05-19T21:29:54.442Z" }, + { url = "https://files.pythonhosted.org/packages/40/0e/e08087695fc12789263821c5dc0f8dc52b5b17efd0887cacf419f8a43ba3/yarl-1.24.2-cp314-cp314-macosx_10_15_universal2.whl", hash = "sha256:f9312b3c02d9b3d23840f67952913c9c8721d7f1b7db305289faefa878f364c2", size = 129670, upload-time = "2026-05-19T21:29:56.631Z" }, + { url = "https://files.pythonhosted.org/packages/3a/98/ab4b5ed1b1b5cd973c8a3eb994c3a6aefb6ce6d399e21bb5f0316c33815c/yarl-1.24.2-cp314-cp314-macosx_10_15_x86_64.whl", hash = "sha256:a4f4d6cd615823bfc7fb7e9b5987c3f41666371d870d51058f77e2680fbe9630", size = 91916, upload-time = "2026-05-19T21:29:58.645Z" }, + { url = "https://files.pythonhosted.org/packages/ba/b1/5297bb6a7df4782f7605bffc43b31f5044070935fbbcaa6c705a07e6ac65/yarl-1.24.2-cp314-cp314-macosx_11_0_arm64.whl", hash = "sha256:0c3063e5c0a8e8e62fae6c2596fa01da1561e4cd1da6fec5789f5cf99a8aefd8", size = 91625, upload-time = "2026-05-19T21:30:00.412Z" }, + { url = "https://files.pythonhosted.org/packages/02/a7/45baabfff76829264e623b185cff0c340d7e11bf3e1cd9ea37e7d17934bd/yarl-1.24.2-cp314-cp314-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:fecd17873a096036c1c87ab3486f1aef7f269ada7f23f7f856f93b1cc7744f14", size = 104574, upload-time = "2026-05-19T21:30:02.544Z" }, + { url = "https://files.pythonhosted.org/packages/f3/40/3a5ab144d3d650ca37d4f4b57e56169be8af3ca34c448793e064b30baaed/yarl-1.24.2-cp314-cp314-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:a46d1ab4ba4d32e6dc80daf8a28ce0bd83d08df52fbc32f3e288663427734535", size = 97534, upload-time = "2026-05-19T21:30:04.319Z" }, + { url = "https://files.pythonhosted.org/packages/9c/b5/5658fef3681fb5776b4513b052bec750009f47b3a592251c705d75375798/yarl-1.24.2-cp314-cp314-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:73e68edf6dfd5f73f9ca127d84e2a6f9213c65bdffb736bda19524c0564fcd14", size = 111481, upload-time = "2026-05-19T21:30:05.988Z" }, + { url = "https://files.pythonhosted.org/packages/4c/06/fdcd7dde037f00866dce123ed4ba23dba94beb56fc4cf561668d27be37f2/yarl-1.24.2-cp314-cp314-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:a296ca617f2d25fbceafb962b88750d627e5984e75732c712154d058ae8d79a3", size = 111529, upload-time = "2026-05-19T21:30:07.738Z" }, + { url = "https://files.pythonhosted.org/packages/c2/53/d81269aaafccea0d33396c03035de997b743f11e648e6e27a0df99c72980/yarl-1.24.2-cp314-cp314-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:e51b2cf5ec89a8b8470177641ed62a3ba22d74e1e898e06ad53aa77972487208", size = 107338, upload-time = "2026-05-19T21:30:09.713Z" }, + { url = "https://files.pythonhosted.org/packages/ae/04/23049463f729bd899df203a7960505a75333edd499cda8aa1d5a82b64df5/yarl-1.24.2-cp314-cp314-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:310fc687f7b2044ec54e372c8cbe923bb88f5c37bded0d3079e5791c2fc3cf50", size = 106147, upload-time = "2026-05-19T21:30:11.365Z" }, + { url = "https://files.pythonhosted.org/packages/14/18/04a4b5830b43ed5e4c5015b40e9f6241ad91487d71611061b4e111d6ac80/yarl-1.24.2-cp314-cp314-musllinux_1_2_aarch64.whl", hash = "sha256:297a2fe352ecf858b30a98f87948746ec16f001d279f84aebdbd3bd965e2f1bd", size = 104272, upload-time = "2026-05-19T21:30:12.978Z" }, + { url = "https://files.pythonhosted.org/packages/5a/f7/8cffdf319aee7a7c1dbd07b61d91c3e3fda460c7a93b5f93e445f3806c4c/yarl-1.24.2-cp314-cp314-musllinux_1_2_armv7l.whl", hash = "sha256:2a263e76b97bc42bdcd7c5f4953dec1f7cd62a1112fa7f869e57255229390d67", size = 99962, upload-time = "2026-05-19T21:30:15.001Z" }, + { url = "https://files.pythonhosted.org/packages/d7/39/b3cce3b7dbef64ac700ad4cea156a207d01bede0f507587616c364b5468e/yarl-1.24.2-cp314-cp314-musllinux_1_2_ppc64le.whl", hash = "sha256:822519b64cf0b474f1a0aaef1dc621438ea46bb77c94df97a5b4d213a7d8a8b1", size = 111063, upload-time = "2026-05-19T21:30:16.683Z" }, + { url = "https://files.pythonhosted.org/packages/a1/ea/100818505e7ebf165c7242ff17fdf7d9fee79e27234aeca871c1082920d7/yarl-1.24.2-cp314-cp314-musllinux_1_2_riscv64.whl", hash = "sha256:b6067060d9dc594899ba83e6db6c48c68d1e494a6dab158156ed86977ca7bcb1", size = 105438, upload-time = "2026-05-19T21:30:18.769Z" }, + { url = "https://files.pythonhosted.org/packages/8f/d2/e075a0b32aa6625087de9e653087df0759fed5de4a435fef594181102a77/yarl-1.24.2-cp314-cp314-musllinux_1_2_s390x.whl", hash = "sha256:0063adad533e57171b79db3943b229d40dfafeeee579767f96541f106bac5f1b", size = 111458, upload-time = "2026-05-19T21:30:21.024Z" }, + { url = "https://files.pythonhosted.org/packages/e6/5c/ceea7ba98b65c8eb8d947fdc52f9bedfcd43c6a57c9e3c90c17be8f324a3/yarl-1.24.2-cp314-cp314-musllinux_1_2_x86_64.whl", hash = "sha256:ee8e3fb34513e8dc082b586ef4910c98335d43a6fab688cd44d4851bacfce3e8", size = 107589, upload-time = "2026-05-19T21:30:23.412Z" }, + { url = "https://files.pythonhosted.org/packages/fa/d9/5582d57e2b2db9b85eb6663a22efdd78e08805f3f5389566e9fcad254d1b/yarl-1.24.2-cp314-cp314-win_amd64.whl", hash = "sha256:afb00d7fd8e0f285ca29a44cc50df2d622ff2f7a6d933fa641577b5f9d5f3db0", size = 94424, upload-time = "2026-05-19T21:30:25.425Z" }, + { url = "https://files.pythonhosted.org/packages/92/10/7dc07a0e22806a9280f42a57361395506e800c64e22737cd7b0886feab42/yarl-1.24.2-cp314-cp314-win_arm64.whl", hash = "sha256:68cf6eacd6028ef1142bc4b48376b81566385ca6f9e7dde3b0fa91be08ffcb57", size = 88690, upload-time = "2026-05-19T21:30:27.623Z" }, + { url = "https://files.pythonhosted.org/packages/9e/13/d5b8e2c8667db955bcb3de233f18798fefe7edf1d7429c2c9d4f9c401114/yarl-1.24.2-cp314-cp314t-macosx_10_15_universal2.whl", hash = "sha256:221ce1dd921ac4f603957f17d7c18c5cc0797fbb52f156941f92e04605d1d67b", size = 136248, upload-time = "2026-05-19T21:30:29.297Z" }, + { url = "https://files.pythonhosted.org/packages/de/46/a4a97c05c9c9b8fd266bb2a0df12992c7fbd02391eb9640583411b6dab32/yarl-1.24.2-cp314-cp314t-macosx_10_15_x86_64.whl", hash = "sha256:5f3224db28173a00d7afacdee07045cc4673dfab2b15492c7ae10deddbece761", size = 95084, upload-time = "2026-05-19T21:30:31.031Z" }, + { url = "https://files.pythonhosted.org/packages/95/b2/845cf2074a015e6fe0d0808cf1a2d9e868386c4220d657ebd8302b199043/yarl-1.24.2-cp314-cp314t-macosx_11_0_arm64.whl", hash = "sha256:c557165320d6244ebe3a02431b2a201a20080e02f41f0cfa0ccc47a183765da8", size = 95272, upload-time = "2026-05-19T21:30:33.062Z" }, + { url = "https://files.pythonhosted.org/packages/fe/16/e69d4aa244aef45235ddfebc0e04036a6829842bc5a6a795aedc6c998d23/yarl-1.24.2-cp314-cp314t-manylinux2014_aarch64.manylinux_2_17_aarch64.manylinux_2_28_aarch64.whl", hash = "sha256:904065e6e85b1fa54d0d87438bd58c14c0bad97aad654ad1077fd9d87e8478ed", size = 101497, upload-time = "2026-05-19T21:30:34.842Z" }, + { url = "https://files.pythonhosted.org/packages/15/94/c07107715d621076863ee88b3ddf183fa5e9d4aba5769623c9979828410a/yarl-1.24.2-cp314-cp314t-manylinux2014_armv7l.manylinux_2_17_armv7l.manylinux_2_31_armv7l.whl", hash = "sha256:8cec2a38d70edc10e0e856ceda886af5327a017ccbde8e1de1bd44d300357543", size = 94002, upload-time = "2026-05-19T21:30:37.724Z" }, + { url = "https://files.pythonhosted.org/packages/a9/35/fc1bbdd895b5e4010b8fdd037f7ed3aa289d3863e08231b30231ca9a0815/yarl-1.24.2-cp314-cp314t-manylinux2014_ppc64le.manylinux_2_17_ppc64le.manylinux_2_28_ppc64le.whl", hash = "sha256:e7484b9361ed222ee1ca5b4337aa4cbdcc4618ce5aff57d9ef1582fd95893fc0", size = 106524, upload-time = "2026-05-19T21:30:40.196Z" }, + { url = "https://files.pythonhosted.org/packages/1f/f2/32b66d0a4ba47c296cf86d03e2c67bff58399fe6d6d84d5205c04c66cc6d/yarl-1.24.2-cp314-cp314t-manylinux2014_s390x.manylinux_2_17_s390x.manylinux_2_28_s390x.whl", hash = "sha256:84f9670b89f34db07f81e53aee83e0b938a3412329d51c8f922488be7fcc4024", size = 106165, upload-time = "2026-05-19T21:30:41.888Z" }, + { url = "https://files.pythonhosted.org/packages/95/47/37cb5ff50c5e825d4d38e81bb04d1b7e96bf960f7ab89f9850b162f3f114/yarl-1.24.2-cp314-cp314t-manylinux2014_x86_64.manylinux_2_17_x86_64.manylinux_2_28_x86_64.whl", hash = "sha256:abb2759733d63a28b4956500a5dd57140f26486c92b2caedfb964ab7d9b79dbf", size = 103010, upload-time = "2026-05-19T21:30:43.985Z" }, + { url = "https://files.pythonhosted.org/packages/6f/d2/4597912315096f7bb359e46e13bf8b60994fcbb2db29b804c0902ef4eff5/yarl-1.24.2-cp314-cp314t-manylinux_2_31_riscv64.manylinux_2_39_riscv64.whl", hash = "sha256:081c2bf54efe03774d0311172bc04fedf9ca01e644d4cd8c805688e527209bdc", size = 101128, upload-time = "2026-05-19T21:30:46.291Z" }, + { url = "https://files.pythonhosted.org/packages/b9/d5/c8e86e120521e646013d02a8e3b8884392e28494be8f392366e50d208efc/yarl-1.24.2-cp314-cp314t-musllinux_1_2_aarch64.whl", hash = "sha256:86746bef442aa479107fe28132e1277237f9c24c2f00b0b0cf22b3ee0904f2bb", size = 101382, upload-time = "2026-05-19T21:30:48.085Z" }, + { url = "https://files.pythonhosted.org/packages/fa/98/70b229236118f89dbeb739b76f10225bbf53b5497725502594c9a01d699a/yarl-1.24.2-cp314-cp314t-musllinux_1_2_armv7l.whl", hash = "sha256:2d07d21d0bc4b17558e8de0b02fbfdf1e347d3bb3699edd00bb92e7c57925420", size = 95964, upload-time = "2026-05-19T21:30:49.785Z" }, + { url = "https://files.pythonhosted.org/packages/87/f8/56c386981e3c8648d279fdef2397ffec577e8320fd5649745e34d54faeb7/yarl-1.24.2-cp314-cp314t-musllinux_1_2_ppc64le.whl", hash = "sha256:4fb1ac3fc5fecd8ae7453ea237e4d22b49befa70266dfe1629924245c21a0c7f", size = 106204, upload-time = "2026-05-19T21:30:51.862Z" }, + { url = "https://files.pythonhosted.org/packages/1a/1e/765afe97811ca35933e2a7de70ac57b1997ea2e4ee895719ee7a231fb7e5/yarl-1.24.2-cp314-cp314t-musllinux_1_2_riscv64.whl", hash = "sha256:4da31a5512ed1729ca8d8aacde3f7faeb8843cde3165d6bcf7f88f74f17bb8aa", size = 101510, upload-time = "2026-05-19T21:30:53.62Z" }, + { url = "https://files.pythonhosted.org/packages/ee/78/393913f4b9039e1edd09ae8a9bbb9d539be909a8abf6d8a2084585bed4b7/yarl-1.24.2-cp314-cp314t-musllinux_1_2_s390x.whl", hash = "sha256:533ded4dceb5f1f3da7906244f4e82cf46cfd40d84c69a1faf5ac506aa65ecbe", size = 105584, upload-time = "2026-05-19T21:30:55.962Z" }, + { url = "https://files.pythonhosted.org/packages/78/87/deb17b7049bbe74ea11a713b86f8f27800cc1c8648b0b797243ebb4830ba/yarl-1.24.2-cp314-cp314t-musllinux_1_2_x86_64.whl", hash = "sha256:7b3a85525f6e7eeabcfdd372862b21ee1915db1b498a04e8bf0e389b607ff0bd", size = 103410, upload-time = "2026-05-19T21:30:57.962Z" }, + { url = "https://files.pythonhosted.org/packages/8f/be/f9f7594e23b5b93affff0318e4593c1920331bcaefda326cabcad94296a1/yarl-1.24.2-cp314-cp314t-win_amd64.whl", hash = "sha256:a7624b1ca46ca5d7b864ef0d2f8efe3091454085ee1855b4e992314529972215", size = 102980, upload-time = "2026-05-19T21:30:59.735Z" }, + { url = "https://files.pythonhosted.org/packages/65/a4/ba80dccd3593ff1f01051a818694d07b58cb8232677ee9a22a5a1f93a9fc/yarl-1.24.2-cp314-cp314t-win_arm64.whl", hash = "sha256:e434a45ce2e7a947f951fc5a8944c8cc080b7e59f9c50ae80fd39107cf88126d", size = 91219, upload-time = "2026-05-19T21:31:01.934Z" }, + { url = "https://files.pythonhosted.org/packages/fd/4d/4b880086bd0d3e034d25647be1d830afc3e3f610e98c4ab3490af6b1b6d5/yarl-1.24.2-py3-none-any.whl", hash = "sha256:2783d9226db8797636cd6896e4de81feed252d1db72265686c9558d97a4d94b9", size = 53576, upload-time = "2026-05-19T21:31:03.909Z" }, +]