Skip to content

Repository files navigation

ESMF — C++ Inference for ESMC Protein Language Models

License: MIT C++17 Backend: GGML Status: Beta Contributions welcome

ESMF is a standalone C++ inference engine for the ESMC (ESM Cambrian) family of protein language models, built directly on the GGML tensor library. It runs ESMC-variants on CPU with no Python, PyTorch, or LibTorch at runtime — the compiled binary is portable and drops into existing C/C++ or Rust pipelines for structural biology and sequence analysis.

The goal is a small, auditable, hardware-efficient runner that produces outputs faithful to the reference PyTorch implementation, with optional integer quantization for memory-constrained machines.

Looking for collaborators. ESMF is an active project and I'm opening it up for contributors — see Contributing. Numerical-correctness work, quantization, and support for larger ESMC variants are the areas where help would matter most right now.


Contents


Project Status

Beta. The full forward pass is implemented and runs end to end; the loader, quantizer, and CLI are functional. Active work is focused on closing the remaining numerical gap against the reference PyTorch implementation across all layers.

Validation. Correctness is checked by comparing per-layer activations and final logits against esm/HuggingFace ESMC-300M/600M on a fixed set of reference sequences. See validation/ for the harness and current tolerances. Quantization accuracy claims below assume FP32 parity has been established; treat them as provisional until the validation suite passes cleanly.

If you hit a discrepancy, the --debug flag (below) dumps Layer-0 activation statistics for side-by-side comparison — bug reports with that output attached are especially useful.


Why ESMF

Running ESMC-300M through PyTorch on CPU carries large memory overhead, slow startup, and inefficient execution. ESMF targets the local-inference case directly:

  • No Python/PyTorch at runtime. Once compiled, the binary is self-contained and portable.
  • Low memory footprint. A compiled ggml_gallocr graph planner computes activations in-place in a small reusable buffer, keeping peak activation memory bounded even for long sequences.
  • Native quantization. Built-in Q8_0 (8-bit) and Q4_0 (4-bit) integer quantization substantially shrink the on-disk and in-memory weights.
  • Instant load. Weights are memory-mapped (mmap), so load time is effectively independent of file size.

Performance

Measured on a single Linux workstation (x86_64, 4 CPU threads) with a 53-residue sequence. Numbers are from one machine and one sequence length; treat them as indicative and reproduce on your own hardware before relying on them. A reproduction script lives in bench/.

Metric PyTorch (CPU) ESMF FP32 ESMF Q8_0 ESMF Q4_0
Model size on disk 1.27 GB 1.27 GB 342 MB 179 MB
Peak RAM (weights) ~2.54 GB 1.27 GB 342 MB 179 MB
Peak RAM (activations) ~1.50 GB ~400 MB ~400 MB ~400 MB
Load time ~2.80 s ~0.08 s ~0.03 s ~0.02 s
Forward pass ~1.42 s ~0.15 s ~0.12 s ~0.09 s
Speedup vs PyTorch CPU 1.0× 9.4× 11.8× 15.7×

Architecture

ESMC is mapped to GGML operations chosen to match the reference output:

  1. Token embedding — input tokens mapped to continuous states via ggml_get_rows.
  2. Transformer stack (per block):
    • Pre-LayerNorm before attention and FFN.

    • Rotary Position Embeddings (RoPE) applied to query and key states via ggml_rope_ext.

    • Multi-head attention with an optimized projection layout: the V matrix is transposed and made contiguous as [L, HD, NH] (sequence length, head dim, num heads) to align with the [L, L, NH] attention-score matrix, enabling fast parallel dot products.

    • SwiGLU feed-forward, with gate and value projections computed in one pass:

      $$\text{SwiGLU}(x) = \big(\text{SiLU}(x_{\text{gate}}) \odot x_{\text{value}}\big),W_{\text{down}}$$

  3. Masked LM head — final representations projected through Linear → GELU → LayerNorm → Linear to produce per-residue vocabulary logits.

The loader and forward pass read block count, head count, and dimensions directly from the .esmf header, so they are hyperparameter-agnostic — supporting a larger ESMC variant is primarily a matter of extending the conversion script.


Installation

1. Prerequisites

A C++17 compiler and CMake:

sudo apt-get update
sudo apt-get install build-essential cmake

2. Convert weights to the ESMF format

Done once, from a PyTorch/HuggingFace ESMC checkpoint:

pip3 install torch numpy transformers
python3 convert_esmc_to_esmf.py \
  --input /path/to/pytorch_model.bin \
  --output esmc_300m.esmf

3. Build

bash build.sh

This produces two executables:

  • ./protein — the inference runner
  • ./protein-quantize — the quantization utility

Usage

Run inference on an amino-acid sequence. Use X to mask a residue for the model to predict:

./protein <model.esmf> <sequence> [n_threads] [--debug]

Example:

./protein esmc_300m_q4.esmf \
  "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK" 4

Arguments

Argument Description
model.esmf Path to FP32, FP16, or quantized (q4_0 / q8_0) weights
sequence Target amino-acid sequence
n_threads CPU threads to use (default: 4)
--debug Print Layer-0 activation statistics (mean, std, first 5 elements) for numerical auditing

Quantization

Compress a converted model to reduce its memory footprint:

# 4-bit — lowest footprint
./protein-quantize esmc_300m.esmf esmc_300m_q4.esmf q4_0

# 8-bit — higher precision
./protein-quantize esmc_300m.esmf esmc_300m_q8.esmf q8_0

Roadmap

  • Full per-layer numerical parity with reference ESMC(FP32)
  • Validation harness and reference fixtures checked into the repo
  • Reproducible benchmark script with documented hardware
  • Support for larger ESMC variants (6B), not yet tested
  • Optional FP16 path and additional quantization schemes
  • Prebuilt binaries / packaging

If you'd like to own one of these, open an issue and say so.


Contributing

Contributions are very welcome — this is a good project to get into if you're interested in transformers, GGML, quantization, or computational biology.

Good places to start

  • Reproduce the benchmarks on your hardware and report numbers
  • Extend the validation harness with new reference sequences
  • Help track down per-layer numerical discrepancies (the --debug output is your friend)
  • Add the conversion mapping for a larger ESMC variant

How to contribute

  1. Open an issue describing the bug, feature, or question before large changes, so we can align on approach.
  2. Fork, branch, and submit a pull request. Keep PRs focused and include a short description of what you changed and how you tested it.
  3. For numerical work, include before/after activation or logit comparisons against the reference.

If you're interested in collaborating more closely rather than one-off PRs, reach out via the repo's Discussions or issues — I'm happy to scope something.

Note for the C++ work: patches that touch the forward pass should state which file and function they apply to, since local and reference copies can drift.


Acknowledgements & Citation

ESMF builds on the work of others:

  • ESMC / ESM Cambrian — model architecture and weights by Biohub. Refer to their repository and publications for the model itself.
  • GGML — tensor library by Georgi Gerganov and contributors.

If ESMF is useful in your research, please cite this repository and the original ESM work. A template:

@software{esmf,
  author  = {Chima Emmanuel},
  title   = {ESMF: C++ Inference for ESMC Protein Language Models},
  year    = {2026},
  url     = {https://github.com/Dox45/protein.cpp}
}

Please also cite the underlying ESMC model per Biohub's citation guidance.


License

The ESMF source code is released under the MIT License.

Model weights are licensed separately. ESMC weights are distributed by EvolutionaryScale under their own terms — confirm and link that license before redistributing weights or .esmf conversions of them. GGML is MIT-licensed by its authors. ESMF's MIT license covers this project's code only, not third-party models or libraries.

About

High-performance C++ inference engine for ESMF protein foundation models

Topics

Resources

Stars

10 stars

Watchers

1 watching

Forks

Releases

Packages

Contributors

Languages